
From nobody Fri Feb  1 00:03:08 2019
Return-Path: <ludwig.seitz@ri.se>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id B9F4513121D for <xml2rfc@ietfa.amsl.com>; Fri,  1 Feb 2019 00:03:05 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -2.043
X-Spam-Level: 
X-Spam-Status: No, score=-2.043 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIMWL_WL_MED=-0.142, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, RCVD_IN_DNSWL_NONE=-0.0001, SPF_PASS=-0.001] autolearn=ham autolearn_force=no
Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (1024-bit key) header.d=risecloud.onmicrosoft.com
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id sKaVcs71CiIy for <xml2rfc@ietfa.amsl.com>; Fri,  1 Feb 2019 00:03:03 -0800 (PST)
Received: from EUR03-VE1-obe.outbound.protection.outlook.com (mail-ve1eur03on0610.outbound.protection.outlook.com [IPv6:2a01:111:f400:fe09::610]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 79C5513121B for <xml2rfc@ietf.org>; Fri,  1 Feb 2019 00:03:01 -0800 (PST)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=RISEcloud.onmicrosoft.com; s=selector1-ri-se; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=TmCGreOwOJycL54gpoSBFud0G+01D/5Lx1dCLIHjJtk=; b=G+9roUBxjSSFA59P39gbQegWiZqWorRQl1dd2xiuB+qU1kQrzBtQI8tQvntbxMKtI4XxcjUTAefPkoYHNP44gLysWoD0uTTFZ2lsLHC7N7lBEHoL9tv7GI2kyOvaEkWGRKV7sXGcS3rMRTDmoRUQA6/pr6TGbd1tnrGFsjHwlT4=
Received: from DB6P18901CA0024.EURP189.PROD.OUTLOOK.COM (2603:10a6:4:16::34) by HE1P18901MB0108.EURP189.PROD.OUTLOOK.COM (2603:10a6:3:9b::22) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.1558.20; Fri, 1 Feb 2019 08:02:59 +0000
Received: from AM5EUR02FT005.eop-EUR02.prod.protection.outlook.com (2a01:111:f400:7e1e::202) by DB6P18901CA0024.outlook.office365.com (2603:10a6:4:16::34) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.1580.16 via Frontend Transport; Fri, 1 Feb 2019 08:02:58 +0000
Authentication-Results: spf=pass (sender IP is 194.218.146.197) smtp.mailfrom=ri.se; ericsson.com; dkim=none (message not signed) header.d=none;ericsson.com; dmarc=bestguesspass action=none header.from=ri.se;
Received-SPF: Pass (protection.outlook.com: domain of ri.se designates 194.218.146.197 as permitted sender) receiver=protection.outlook.com; client-ip=194.218.146.197; helo=mail.ri.se;
Received: from mail.ri.se (194.218.146.197) by AM5EUR02FT005.mail.protection.outlook.com (10.152.8.173) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256) id 15.20.1580.10 via Frontend Transport; Fri, 1 Feb 2019 08:02:58 +0000
Received: from [10.112.134.122] (10.100.0.158) by sp-mail-2.sp.se (10.100.0.162) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256_P256) id 15.1.1531.3; Fri, 1 Feb 2019 09:02:57 +0100
To: Henrik Levkowetz <henrik@levkowetz.com>, Carsten Bormann <cabo@tzi.org>
CC: XML2RFC Interest Group <xml2rfc@ietf.org>, =?UTF-8?Q?Ari_Ker=c3=a4nen?= <ari.keranen@ericsson.com>
References: <50228553-c0fe-c199-e3dc-452a381c5c64@ri.se> <86BE97C4-96C9-429D-8D5F-805B4F21FA74@tzi.org> <84b03322-1371-4918-c325-a40e228316c2@ri.se> <a0c6391f-78ea-891e-3714-5e6f82d0602b@levkowetz.com>
From: Ludwig Seitz <ludwig.seitz@ri.se>
Message-ID: <ca24b4cd-9668-80da-ca70-37797f4bb141@ri.se>
Date: Fri, 1 Feb 2019 09:02:48 +0100
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:60.0) Gecko/20100101 Thunderbird/60.4.0
MIME-Version: 1.0
In-Reply-To: <a0c6391f-78ea-891e-3714-5e6f82d0602b@levkowetz.com>
Content-Type: text/plain; charset="utf-8"; format=flowed
Content-Language: en-US
Content-Transfer-Encoding: 8bit
X-Originating-IP: [10.100.0.158]
X-ClientProxiedBy: sp-mail-2.sp.se (10.100.0.162) To sp-mail-2.sp.se (10.100.0.162)
X-EOPAttributedMessage: 0
X-Forefront-Antispam-Report: CIP:194.218.146.197; IPV:NLI; CTRY:SE; EFV:NLI; SFV:NSPM; SFS:(10009020)(396003)(136003)(346002)(39860400002)(376002)(2980300002)(51914003)(199004)(189003)(186003)(8936002)(478600001)(67846002)(6666004)(36756003)(386003)(53546011)(69596002)(8676002)(81156014)(64126003)(81166006)(356004)(33896004)(16526019)(68736007)(476003)(486006)(31686004)(11346002)(2906002)(2616005)(126002)(53936002)(446003)(93886005)(65806001)(76176011)(336012)(6116002)(305945005)(22756006)(50466002)(31696002)(74482002)(7736002)(106466001)(97736004)(2486003)(104016004)(316002)(14444005)(3846002)(77096007)(6246003)(58126008)(65956001)(44832011)(4326008)(229853002)(65826007)(16576012)(106002)(54906003)(110136005)(47776003)(86362001)(40036005)(2870700001)(23676004)(26005); DIR:OUT; SFP:1101; SCL:1; SRVR:HE1P18901MB0108; H:mail.ri.se; FPR:; SPF:Pass;  LANG:en; PTR:InfoDomainNonexistent; A:1; MX:1; 
X-Microsoft-Exchange-Diagnostics: 1; AM5EUR02FT005; 1:YxiSRH+Yx90sgF2RzVYmiVNTklD4gJ1Y0/3xxR2BsU6+rqOX1sUjqX9MyS5A46mPc7uDmS1ESRccLG4F5BNfBnhAM/la+yjUGBkcHk7GidsxU4KqGPVkAZeh2r0kUXqV4N1gjunmmc5IymvqoLKDhogD7ryEIrbxcHG4FidqDME=
X-MS-PublicTrafficType: Email
X-MS-Office365-Filtering-Correlation-Id: 7c0b8534-4794-41c3-19e8-08d6881bae00
X-Microsoft-Antispam: BCL:0; PCL:0; RULEID:(2390118)(7020095)(4652040)(8989299)(4534185)(4627221)(201703031133081)(201702281549075)(8990200)(5600110)(711020)(4605077)(4608076)(4709027)(2017052603328)(7153060)(7193020); SRVR:HE1P18901MB0108; 
X-Microsoft-Exchange-Diagnostics: 1; HE1P18901MB0108; 3:Gn8evuIPS2I8fR4V/RI8zGf1W9rC06HH9dN4XqON2/vCghYgYoBe3kEY2Mu36cHM+OUId5uCR6q3ghYwsXpYqD0JGmO/XN0iXinZ0tmzVNtV43lVq4ivQbCOJ9TJ/gMhEPkJJ1WIX0VTJznTKZzW9WIFB21/2LobEdlppihGpZ9rlIp08I85BUhPswQqBzfU+Ib6ND+EOO5/4lkN6qKlxYvb6mFUWLcSdR4+ZaJl2cOa8utJJas1SDJKTvNnzZrC/ECWjS3Ix5lRN52txp9aUjUjw6tQqctxRHlTg7398QMpzP+eD0l0q5lusu5oVnzgjEp8k0mw5x+QqYUHLBhskvwMR6z4aQAYqKCBqRc+tA/XnwmeLsl8SSW5tRgzMhSz; 25:+MmYD7+OU3WYTnKpfzXfIrDUCXnOgYUZIAD/+WMAFb3UnjLcX7K6egyzLWkigCYw80d0cBo/QJug49Ivtx3nShD6WC/WCUlm/QJ4yRhe/TwolhTlRvoLFcot+BwU+XZOymzFR7UG0pM9/33JQjh1ygx4vqmNy74Gs+UIwGma+HZ5inyXZn6e9GuQG9xcBrBVOdpAV5llOjjzdnb824EIh2C0Rh3s+ckWGn0bo12oxFrS+MUZTYDN/W+XAnQZfo6wnjo3aygZjfhQ1zdFsxXwqEYUc5Ce3VAdeou/9iZa3ZMUv8d93xSGOpp9LP1MHuO8e13JLQiEnBfKJYZXn/yvDQ==
X-MS-TrafficTypeDiagnostic: HE1P18901MB0108:
X-Microsoft-Exchange-Diagnostics: 1; HE1P18901MB0108; 31:78NQ0bckLnMeswqhuce7kMJNWTIJ4IVMPzmBtAiv9kbX9ndtv4DaiVKAf715qrHB1no/+XJ3BocNds76denVxgcnAfnSgWQdVYG0GJ0FvZMdNrCMsXRxTZfrKNknjYPBQ657yvYyBGUh8KMt6TltOjNLb+lqLNHWhde2FgQRFKrWnDg2eLXur9TMDnLB8X7YTtJ4RVgz2hyVHauX7dhi5ACibO5JYTxE2XEPh0gHinI=; 20:l1bGU1ULfpI/lcf0HmAdbXBYre8jk4HMjSkkvy9DdSOzPLsJ6jmxvxfU732gY6H4yZby9W3W+eBzfwtLtHzxs2Sn1u88K+Qkec8ELCGE5MIoyPTSAiFZF1Him7SLQuTwFlAlbst42DqtVifABz7hvF9+N1B/EDVu79leOoSw58sTfd4TdWeYWBuhwrd0L27Unf9FXo4ytZQahfi3m2/ROAlrGXMxXpj77F0CV/Ed0eQ5mwtcJFiPdmAlMWQcTF+q; 4:7gILZgQnvGYHPCzFbDV13eWkUX80bdqckXAZtuMr+fl+9n6/DHzBrsqkPEIOqNgZdPjI4oKzI9Io1Rhuk2FzSnfaYDPTyz/P1hktOGq4RzfB7lDR5vIZCvt+fEPmA2EuWkr1yZK8dj1yxXBQE7bJu+tqnwdjarpsU7diaFW0zLTFxSaHTUzpAhD4Jj6+Gx9Bs+hGo6rudFV4wFXFwM91eCkBjsSF2HEN2kHPD25LI4p0QBQHr9Y4s9cCb8M41TfYvkH0YiGjcSeccY4I+h+9EjONDzcvP/342JuPjHQg1NdmEXwBKbAqn7DsVJUy4P3W
X-Microsoft-Antispam-PRVS: <HE1P18901MB0108C1A1B27B6D89D480186C82920@HE1P18901MB0108.EURP189.PROD.OUTLOOK.COM>
X-Forefront-PRVS: 09352FD734
X-Microsoft-Exchange-Diagnostics: =?utf-8?B?MTtIRTFQMTg5MDFNQjAxMDg7MjM6RnBmamZ6UXg5SlVLSmF4WnF5dDgxdXBi?= =?utf-8?B?b05jS3ZvMUZlUmlzNHFOV0xBdE9IeEpuUVFENXQ4cElpTnFqTHNSL2xhcnRo?= =?utf-8?B?elNYN0ZHVmdVSTFlTEN2K2dVKzU1NVVkY2JYbmdFTmRWTkoxOS8zV1N1eUtR?= =?utf-8?B?NFFYMEt6NmRoemhEdnZMQnJyZDR6Wm1zSWp6UERWdkExVWI3dTA1cVo2SkRF?= =?utf-8?B?R0V5QVplekZNUUZ5ZnQ4alZHMmNOdUZnTU1Od2VScFRXMlJscUhoTExtcU5U?= =?utf-8?B?VVZNRHB6MFVpR0N5MG9LV0FVZFphcWdJUkNYd2x3TFZUY2tEU2ZjSXdMUVVq?= =?utf-8?B?ekJrdDlBU1VrQVIvTEhIVGx6N3dZK3RTbmV4Mys3UzhCbDc4cEZzTnpYWG1m?= =?utf-8?B?QmhJWSs0d3M3QXp0S0dxZjVzZ3hXeWhFYnFKME9KcHZmbGZ0OUVlLzc3REtT?= =?utf-8?B?dVRGbXR0MmFUUHJGdXRyVjZIelJxVHBBUDkyVExnL2p0WFlMdC8wTUJ0ZUNU?= =?utf-8?B?ZGlFeGdDVXd4T3lTK2FaVXpnOEZaZlplZk5lMjBuSHlzMEdJWVV0bzR4Wjhr?= =?utf-8?B?aHF2Smk2d2pJcjdmZmlBWjdTNmpaQzkvVngwRElMckV2UkV1T3VSaDFZcGhu?= =?utf-8?B?cVh5MzI1bjZKSHRMSXRTK08vSFJOSHI4VGdjM2dzZkszTHpoTmR2S3k0U28z?= =?utf-8?B?NWZSSUJaVUFvbE1pblF1bVN3Zkd1NFRIaEJwcndEMkVpY0VrUmtOUFhzY2k0?= =?utf-8?B?YktMRTZxMy95WndlQUlSNnJIZnk1bjkydXlSL0FvR3RVYnNueXhRRGtWc1Fu?= =?utf-8?B?QXFSQVhkaExGaGpwbVJ5WWU1VXVUK3h2b0s2bGJ3b05jT1l0UERlL0lHRUEz?= =?utf-8?B?OE9Qb2thRHJmWVhhR1d6VG9PRnZ5UGNRNTkzYmdkbnlwODBEVkl5TVNCU2ZB?= =?utf-8?B?TDVCVmxZREpSRElpTEFJSlptMWpaL0djZ3ViWkpwbDFKbk02YWdSNExvYkph?= =?utf-8?B?WnRYSHQvbG95OHBVWVMwZ25ISHJVL2ROdXZVbW1kMzB1N1RZeWFDb3ZjaGJp?= =?utf-8?B?KzVrRVMvYXBmTWpuN3JPYnlTbW1xTGZqeHBQVTVFWUt2bzJLajVRZElaVmFH?= =?utf-8?B?R0hQNysxZENmemNyUkkxZ3U2UGQwOGp6WERNTkQ3aFprREkzbmFVN0VJZkhF?= =?utf-8?B?Ujl3QTBrVmlLMkF2WllQOXV3MzR2NzFYQnlHMEczOEtOcVFwbktaV0d3clBM?= =?utf-8?B?WlkzRDFtdmxjUmxHTktDaElKb1Y4NUo2eDlFelhhT3hnSWdhb0F4d3FKVCtm?= =?utf-8?B?bDEyR0xPUEljZXY0bGlzM201VXpsTWdoVGp4Wko2STdJcERPdGh3MWpPWE9I?= =?utf-8?B?amYvbzV5ak9oYlFxWmtMOEZJR3E2MkQyK0tnQjZ4cGM5eFJGNjhua3ZtN3Vy?= =?utf-8?B?RmdhWUhKQ1VtaG96VEtyN2lEaWtsdTVuV0NTdWlWalowSmhmbWlSTFE2K2Fp?= =?utf-8?B?YU5CR0grWG9Xa2hEbTAwZE01cC9jd3JNQjVSVTlDZy9LRUowT3AxTnl1WVV5?= =?utf-8?B?OTVhN2tHR1ExN1lIbFpLTTBhVjhvQy9USnJqVUdjVmU3N2FIaGdlNllPdUw4?= =?utf-8?B?bjQ0WXJrdXRhODNSSkdrc2k2T2x4SFdxa3prZW9pMGZvSGZ3bEl6STZ1UCtS?= =?utf-8?B?QytubDBXN2g3OFRGRlVscy9QalpBaHRHZFlvRENueGpEcHY2MFdSVk5YQ0R3?= =?utf-8?B?cGFDdEVXMkhDQ054UmlZOFNJckZqblJqeGtGUVpXYm9JYkk3N2dQalhtT0lP?= =?utf-8?B?dkQxOTI2dWgvY2hrLzFiYUFZTGRRT1Y5OThVemkwck92Y0VuSitrQ1NhYTFl?= =?utf-8?B?OGlhZVU0M3o5ZmdoUG54UklscUhJTHZOd3E5dlMvOHNHQk5xYjdHSWFnZ1ZC?= =?utf-8?B?ZnB3UDVRNFBOWDZMbXpwVlRUbE1UakROVklMSEtPNFhoK3hHR05GNm5IcW1w?= =?utf-8?B?VkpiTzhuOEUzMnJpNzZ1aE5ubVZ3cFA2VTNLQkpSUTlxT3VrWFdUQkVvUUd4?= =?utf-8?B?OCthWjBlWUdUZUlhZjZxaXNwL3dOUnNLOFA5TUVEYytKcm9mVmpIRDdVR0FI?= =?utf-8?B?WVdCZz09?=
X-MS-Exchange-SenderADCheck: 1
X-Microsoft-Antispam-Message-Info: ue05rZXsMd+yZSkAgXex385YQmXJ7aKCdknGmU//AgzOI2ZbIhrIW1jsttXawFMm5hpEpHDu/TlIjY3oBe4gOWDCiujlJ58jUpZ452fWTJkYEEVbpAtBBV4YbG2H/dtP2UF1mtrQegtpoH0BI0Y0cSaSX8YLnuZZljrKDXVIyLLHfSjFvjKeRIB5kt8jPL6hisl5VYBUVPoZ3rHV3RUNYhWkiKcEmzb47BLwWIE6vMwwSfiQKcLwct8isW5rHGRSQ43SIQPTEVnIKQmSb2EDVZh0ld+Tl3dQrnE9UD/bHZArXuGSUdA2Hmt8uV2Q8ciI1qfEHzE2HIrXr1t5vDyRPszrMzP/JtflRMMlXDX7Qq/r4gEtvMJmfrmJlwm/cBVpfyfqKWF58/NOSAGmLkFLriY3t/+A7m77znzt8YQ5EF4=
X-Microsoft-Exchange-Diagnostics: 1; HE1P18901MB0108; 6:Nc05TAkHl/Kf0Sw7on+ozo55BKsukQ1WTitSRQzorql3bT8+n34fDaY8JLJqZNvu4qQ02ZvoCYABTYeYaiebHpLna7E3E+Wpf4/rD7RxtFfNjMeyv9RDZTgdLbDJz3DDZyBe0mj0zGw1X/vylXxXMQVDIsteDLIH+qIIG94mEULoybJXpKNEhe+axeo2Zv6PIgKPfDzJ6OIkQsPhXR7BCmefVf/8N7BOwTptZJlg/U/CwXmfoP1NUP2QfdZrfPGsVIZdiAehqIDMUaYScw5IsXKdNKGsh5FAPo8a6L7oJtaEBO8e/VT5mSaoOUe+VdVIttMenurmdIus0sFKq7cK5Q23GOEcqIDJY5g1ndsd3BkGAbfXyLs5Y4PhrpfoGX0HR4OVRgqiuHYr9LmJlJpqh6eUk6nJVeRFINAAl9riK9w7dV/tHvnajBmA/S7nxBnBIm9USKk/yp51FOIf3it02Q==; 5:9rLk0GmPkgumPOs1mjSt6UGD5SbbWuNmTkuZ1y2tBUDXBQAisQsEZLeDfCI053y7feRSOt86+oiifaFbJKWtbkutIci9SIGz+ZDWBISDutQQytSmkTtMFa8u4oWG943+kWdrhJFH9mNGnBIbwIwIUTJ6kATkKzBn3FZs4N8soKlyaXchCl/BaRSHEMbvXkscFmeAYvBEyHT0aIDuCCruVw==; 7:c7r9tW1KxOcT903qtw91z7ZVWXws8lp9KYz13PGN8oZmc3IkxbJ6hkem0O3Ho6rKbgNI2XjkDIaIrkV1VgSduRXGHMlOWl9jfrksN1W6+XryX7lgoo0yr4lvS86BA4xopr45jm/w5TazZKcw+KveoQ==
X-OriginatorOrg: ri.se
X-MS-Exchange-CrossTenant-OriginalArrivalTime: 01 Feb 2019 08:02:58.3029 (UTC)
X-MS-Exchange-CrossTenant-Network-Message-Id: 7c0b8534-4794-41c3-19e8-08d6881bae00
X-MS-Exchange-CrossTenant-Id: 5a9809cf-0bcb-413a-838a-09ecc40cc9e8
X-MS-Exchange-CrossTenant-OriginalAttributedTenantConnectingIp: TenantId=5a9809cf-0bcb-413a-838a-09ecc40cc9e8; Ip=[194.218.146.197];  Helo=[mail.ri.se]
X-MS-Exchange-CrossTenant-FromEntityHeader: HybridOnPrem
X-MS-Exchange-Transport-CrossTenantHeadersStamped: HE1P18901MB0108
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/ybE9Xw15eM809dpEcSzE1ObXhFQ>
Subject: Re: [xml2rfc] The bibxml entry of RFC 8516 creates an error with xml2rfc
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Fri, 01 Feb 2019 08:03:06 -0000

On 31/01/2019 16:31, Henrik Levkowetz wrote:
> Hi Ludwig,
> 
> On 2019-01-31 15:05, Ludwig Seitz wrote:
>> On 31/01/2019 14:13, Carsten Bormann wrote:
>>
>>> Something appears to be really broken on your side.  How does “ä” (which is &#228;) turn into &#258;[currency units]?
>>>
>>
>> More data:
>>
>> I'm also using xml2rfc version 2.5.1 on a Ubuntu 18.04 machine. I can
>> reproduce the error (even after manually deleting the cache file).
> 
> Version 2.5.1 is quite old (released 19 Oct 2015) and a lot has happened
> since then with respect to non-ascii support.  I'd suggest upgrading to
> a newer version through 'pip install'.  If the 2.5.1 release had the --utf8
> switch, you could try to do a run with that switch specified to get around
> the immediate issue.  But even if that works, upgrading to a newer version
> seems advisable.

Confirmed, after doing some back-flips (see below) to get xml2rfc 2.17.2 
installed and deleting the cache file it now compiles correctly.

The old xml2rfc version is the culprit. Thanks for the help in hunting 
that down!



/Ludwig


PS: Backflips = pip uninstall xml2rfc, pip3 install xml2rfc, xml2rfc -V, 
hmmm... still  V2.5.1, pip3 uninstall xml2rfc, pip install xml2rfc (out 
of sheer despair), xml2rfc -V, oops suddenly V2.17.2

-- 
Ludwig Seitz, PhD
Security Lab, RISE
Phone +46(0)70-349 92 51


From nobody Fri Feb  1 03:24:20 2019
Return-Path: <ludwig.seitz@ri.se>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 1079B13121E for <xml2rfc@ietfa.amsl.com>; Fri,  1 Feb 2019 03:24:17 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -2.043
X-Spam-Level: 
X-Spam-Status: No, score=-2.043 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIMWL_WL_MED=-0.142, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, RCVD_IN_DNSWL_NONE=-0.0001, SPF_PASS=-0.001] autolearn=unavailable autolearn_force=no
Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (1024-bit key) header.d=risecloud.onmicrosoft.com
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 9ZDPtM8waFnh for <xml2rfc@ietfa.amsl.com>; Fri,  1 Feb 2019 03:24:13 -0800 (PST)
Received: from EUR02-HE1-obe.outbound.protection.outlook.com (mail-eopbgr10068.outbound.protection.outlook.com [40.107.1.68]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 7CD40130EEE for <xml2rfc@ietf.org>; Fri,  1 Feb 2019 03:24:12 -0800 (PST)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=RISEcloud.onmicrosoft.com; s=selector1-ri-se; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=tlv9l8nCc23UodxgQ6ayGvAQnOf2/TDUJ6olFQ+sUdI=; b=RHEAPlkEvWh167jhIWTCXak0fk2Lc7Ek6IBFWFBc/7sVc9xl5szqBtNu9UxlFrj8twbUnaZwTtpEsIYjPNuC0CVUF4YYx1fy2mOyyY4twqSRCrrrVpF9vAcBinPZ05iPxsX3QOhSlPy4S0Rhlc5OwV4YQLlI1Jvwea5nuCNTCT4=
Received: from AM5P189MB0323.EURP189.PROD.OUTLOOK.COM (2603:10a6:206:20::16) by AM5P189MB0323.EURP189.PROD.OUTLOOK.COM (2603:10a6:206:20::16) with TransportReplication id Version 15.20 (Build 1580.16); Fri, 1 Feb 2019 11:24:09 +0000
Received: from VI1P18901CA0022.EURP189.PROD.OUTLOOK.COM (2603:10a6:801::32) by HE1P189MB0330.EURP189.PROD.OUTLOOK.COM (2603:10a6:7:58::23) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.1558.21; Thu, 31 Jan 2019 15:47:04 +0000
Received: from VE1EUR02FT019.eop-EUR02.prod.protection.outlook.com (2a01:111:f400:7e06::206) by VI1P18901CA0022.outlook.office365.com (2603:10a6:801::32) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_CBC_SHA384) id 15.20.1580.16 via Frontend Transport; Thu, 31 Jan 2019 15:47:04 +0000
Authentication-Results: spf=pass (sender IP is 194.218.146.197) smtp.mailfrom=ri.se; ericsson.com; dkim=none (message not signed) header.d=none;ericsson.com; dmarc=bestguesspass action=none header.from=ri.se;
Received-SPF: Pass (protection.outlook.com: domain of ri.se designates 194.218.146.197 as permitted sender) receiver=protection.outlook.com; client-ip=194.218.146.197; helo=mail.ri.se;
Received: from mail.ri.se (194.218.146.197) by VE1EUR02FT019.mail.protection.outlook.com (10.152.12.107) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256) id 15.20.1580.10 via Frontend Transport; Thu, 31 Jan 2019 15:47:03 +0000
Received: from [192.168.43.219] (10.116.0.226) by sp-mail-2.sp.se (10.100.0.162) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256_P256) id 15.1.1531.3; Thu, 31 Jan 2019 16:47:03 +0100
To: Henrik Levkowetz <henrik@levkowetz.com>, Carsten Bormann <cabo@tzi.org>
CC: XML2RFC Interest Group <xml2rfc@ietf.org>, =?UTF-8?Q?Ari_Ker=c3=a4nen?= <ari.keranen@ericsson.com>
References: <50228553-c0fe-c199-e3dc-452a381c5c64@ri.se> <86BE97C4-96C9-429D-8D5F-805B4F21FA74@tzi.org> <84b03322-1371-4918-c325-a40e228316c2@ri.se> <a0c6391f-78ea-891e-3714-5e6f82d0602b@levkowetz.com>
From: Ludwig Seitz <ludwig.seitz@ri.se>
Message-ID: <4fa0190f-fd19-3907-caf7-2cdfee7477a9@ri.se>
Date: Thu, 31 Jan 2019 16:46:47 +0100
User-Agent: Mozilla/5.0 (X11; Linux x86_64; rv:60.0) Gecko/20100101 Thunderbird/60.4.0
MIME-Version: 1.0
In-Reply-To: <a0c6391f-78ea-891e-3714-5e6f82d0602b@levkowetz.com>
Content-Type: text/plain; charset="utf-8"; format=flowed
Content-Language: en-US
Content-Transfer-Encoding: 8bit
X-Originating-IP: [10.116.0.226]
X-ClientProxiedBy: sp-mail-1.sp.se (10.100.0.161) To sp-mail-2.sp.se (10.100.0.162)
X-EOPAttributedMessage: 0
X-Forefront-Antispam-Report: CIP:194.218.146.197; IPV:NLI; CTRY:SE; EFV:NLI; SFV:NSPM; SFS:(10009020)(39860400002)(396003)(376002)(346002)(136003)(2980300002)(189003)(199004)(3846002)(54906003)(33896004)(50466002)(6116002)(69596002)(2870700001)(31686004)(65826007)(14444005)(229853002)(117156002)(4326008)(8676002)(86362001)(67846002)(316002)(22746008)(53936002)(110136005)(2906002)(81166006)(93886005)(6246003)(58126008)(106002)(81156014)(23676004)(16576012)(2486003)(31696002)(76176011)(36756003)(68736007)(44832011)(40036005)(77096007)(11346002)(486006)(65806001)(74482002)(97736004)(47776003)(126002)(65956001)(8936002)(2616005)(53546011)(446003)(476003)(386003)(7736002)(22756006)(6666004)(106466001)(356004)(305945005)(186003)(104016004)(478600001)(16526019)(64126003)(26005)(336012); DIR:OUT; SFP:1101; SCL:1; SRVR:AM5P189MB0323; H:mail.ri.se; FPR:; SPF:Pass; LANG:en; PTR:InfoDomainNonexistent; MX:1; A:1; 
X-Microsoft-Exchange-Diagnostics: 1; VE1EUR02FT019; 1:M26lX0/NtzAD+B/8DnjtmanlAdntim41EOdbF9GHhJPj38Il5QwyDuDinurlJKkq4Nk8q841z/dzKXTa7gF8qeYiXtIpR7kfArECDxYxmxNZ6TEpFFO9xsmfA8FFK2ND2Qzi6tFSI0T5s3Bzv2GhSQ==
X-MS-PublicTrafficType: Email
X-MS-Office365-Filtering-Correlation-Id: f24f15c0-9ccc-4d42-292e-08d6879358de
X-Microsoft-Antispam: BCL:0; PCL:0; RULEID:(2390118)(7020095)(4652040)(8989299)(4534185)(4627221)(201703031133081)(201702281549075)(8990200)(5600110)(711020)(4605077)(4608076)(4709027)(2017052603328)(7153060)(7193020); SRVR:HE1P189MB0330; 
X-Microsoft-Exchange-Diagnostics: 1; HE1P189MB0330; 3:wL/4CqoszbpM8Syl5zAS3iVVLcfgBT1KCL7lCWVxXQq9CkpjQ63HPI1PiqRU4vObNsGNw+x4JR5qitWdPWUsNdUVOGiR6PeSzuDBDSqPNrVflq0P7ElT3cyYwrGlipOA9hG90CHEwHr2cTkKuka7K10gkJ+qSrl6yXinZ5qr0Dm7bAkqzPDF3hMElfTQPAJfIhYxqPtMUzSIXqr4GNH9xOpsYtBKVXmfJnFkhjwHBsWCdHw+swI9lvDqyoFFLK4N8UCqpYDiXlXk43OU1Ie5//g1xppaqhcsfHOwMz1f09gMD1wEzLcsDbHVEjOyaIfxmzNiwSyvKDGC3ck5m+Q+QmWygy4p7KZYN4DLLxdG6aG1HCJ/yFslfy+WX3UQKkF6
X-MS-TrafficTypeDiagnostic: AM5P189MB0323:
X-Microsoft-Exchange-Diagnostics: 1; AM5P189MB0323; 25:D9v6R+u4i5UFBipcExy8FAYrsxZA3ZxEIoRoV2xOe8rHEwF8aM5cOnKX62VM6c9xhyblNB3L0Q6dOEsuuVnXMdi6eH5da2A4EybyiEFEaPcdoKfiqPkXluDPevuzh3d7dTn4fu+pXIWHTx0utI6ciPuhI5aoezqDAHNB1AcgoMO+UheTl3ukSDXyMgPLnPrDdK8BnLnCAuYMLSoE1vlplltnIgJKceRDfQeLxai0ySsd8HtOZTVrV9/oFsXfBxVNgvIYg3mq2BthiZcQfNvsjwcXxYjjTk8LrE4NR0bCgtf3kzaKk3D77cM62l6ctq3/twABN9Tu86sfCQrQ775bIQ==; 31:PJDNqP4iCas9s1LdmrxOejrwkyLNb8ruvc5mGDiJJJ6UHiPO9169sNIb4c9b1c5MKHaNfOZdaKVxhkQ6uj+Y8L9k8GUiAv8U2vEls57PexqUPXmgzk/RmkUo5DPYp5+JRfKQ2DWrnaIxFamxuMyrDu1XVsjrXP12OGXDtFmjTmJhMj3QbIzy5NJW7sGFZRrHnQYB3rvZHbt1XcFjDTWKXYbLsfI9VGNtpdMcMLRuCoI=; 20:+VUrZSvtGGoSNlw4numqOD8wwfb5V7e8AppF/p9abKL79y5Zsa3fNvLAY7cD6CEgvekdP8IIOFOkezXlyBD+WKkCNgNNSBkSvZzDjZDzCzOcIWBU643PBR879iZcf8LwZMlydaoJ9NqkCwIg0DDmOZDops4JtRI1uf4EE6LZPC0vLdw0XVmPygBmjiFAEYYWq9eGlyCR1nymlSBTSkdvpcpT/yqE8CYK7dnOAWj8zSFGWlL6OYJj+h257GgLqnnL
X-Microsoft-Antispam-PRVS: <AM5P189MB0323CA97F2F7035BB1320EC282920@AM5P189MB0323.EURP189.PROD.OUTLOOK.COM>
X-Microsoft-Exchange-Diagnostics: 1; AM5P189MB0323; 4:NRviPXtyNJSz9EG5zpJtNNTSBubQFlR/hJeuvq8gqDB5lM44hGziye96WpzAZ9BcQ481T08TFMYFW2wntzEucSgVlEw463pM0z0OtHu/592pKMpUnrF2Oe/YoU5yKQQpnJDFrUItgVr/3rfMrhksiWo7wQPUfJtkSrTQ8uy5KPuF3cRAGbE/DQo1PztRyCeTFnr1ZHXyGkSjzTSbQLF+W9mG0ZCmRItI4SfGHk0bdGnkvcECuIubTMGcoGDYL/yR49Rivbl0YglMYYUW8Ycwdnkfq8BSbNCy7K5WErFQ9uHVAu4wOXwNBs0s8VlzkASd
X-Forefront-PRVS: 09352FD734
X-Microsoft-Exchange-Diagnostics: =?utf-8?B?MTtBTTVQMTg5TUIwMzIzOzIzOkdPUFNrQ1dHaExTWHo4bDJha0xDYVVuWENu?= =?utf-8?B?Y3BxcUZMaHFxSjZMQ1VWQlc5NkdWQk9ERCtzcGVMRXdwMXhZOG81NGNJYjN5?= =?utf-8?B?bDB5Y0RiNVJrL0RjeUdjS25XS2lhK0ZKbEZtemlPM0wxL2hQWkxTeFpNUmJL?= =?utf-8?B?L0JDRWVKTzU4LzloM2tISngxZ0tua3NLTTI2MU5HZDZRMzR5UGdYMDh5bzdk?= =?utf-8?B?Y0MyWlZzVFI5ZlVsNlFqT1Z3N1ZtMFh2RUlGcDQxcTJSTzFHVWFiQXR3NnpX?= =?utf-8?B?Z25JejU0a1hXQ3BYOEwwYXZudW9KeVRBYkhsOW05cVVxSnlSSXQzN0tNcHVY?= =?utf-8?B?VGFqSmpDMmVaQ0NnYkxwckNta1AzWjMxT0JqdG0wK3FScUpVR204UCtkQjV4?= =?utf-8?B?azZPUHVpbjd6alNpbzA2NlcxN25NMTZkdWsvck9ZeG9VYlh1b0Nla0N5bjlN?= =?utf-8?B?cC9tZ0pDaHBXMUhRNEZ1T2QrZUFYSURvWFB4UUpOSHdYL0NDd0lteUJTNjc3?= =?utf-8?B?UDlZaE9CRExiVWJpbVBnRGFxU014ZTBLSzZuM0h1dXRxeWJUb05UYlFqcFlz?= =?utf-8?B?dUd5T24yS3MvNDU5V0pCYmJpTjBGMlZWL1dscDZQK2Qxemt0U21TWlFFUVJJ?= =?utf-8?B?NWJuVjRvT1FmcmR2VnEvSng0RkxWVUU0YnJKM0lhMU95QUlpOWlOdEJTNGVJ?= =?utf-8?B?QkxtanQ4aWZEdTlPVDFQZ0NXa0xnQWdPR0xXMnlFSlBZYWZqcmh0cXVYOGNz?= =?utf-8?B?WkdiR2ErbXN1QVpMU2ZYZFh4SXIwQ05uNCtHdmFRRmw3K1pUeHRhNzdjOERF?= =?utf-8?B?c1M3VHZQK09pVUN2QTRVRXpMeUIwZXBUaCt3Q0liK0lkNWxXTkViVGpxYk5V?= =?utf-8?B?YUFaK3AzMnorYVdnaHlIczErUGlIclVjUm9nSGtKYjNDZUlwQWkzVEVKWmda?= =?utf-8?B?TXNCS2d6TjRnOGtaRHFjYm5tQ1ZCaEdBL1QzbExycTdDZ2ZMV3l3eTJvdTJE?= =?utf-8?B?NFhEL21iTjVic0k1eDAyUmF3Nm5MbDZqL2U1SzVpM0ZaaUhxR1B1aVYwMEdT?= =?utf-8?B?Ym9sZFhnbjd5VWZtcytIeUVKVllLMnpRRWZiZzI1aXErdS9YMStKMUIyc0lZ?= =?utf-8?B?UWZJU21KSmljUWFWSi9oVmJheFFvSTNtWVNONVYwbTRFNkFXdjJ2ZkF5RUVm?= =?utf-8?B?T2ZkYlVLUnJ2N21meWR6NDl5aFJSSHpOUEV1ZENhRXU5SWtyWjQyRTcrRE5P?= =?utf-8?B?M0IySGpUblZUaHptSWt3NHh2NGJOaVZKMHpuSFNud1hhMG8xVjU2NkZ3cThM?= =?utf-8?B?bFYybVR6SVYrZTZUZUdmSDhvZ1JrYnQ0cktxZGUzNUVNMjF6c0JVSTRXeno4?= =?utf-8?B?eVRJdytHejh1UTZINzhtNzRDNTBodDZtOThQSlpYbDl0eDYycFFjTCtVaFh3?= =?utf-8?B?UXpBb0tKWXBweXNUakhnOG8vdTZ2V1A5dHUwdlgraWJxTU85eHduNytucUFx?= =?utf-8?B?Z3dJb1hPYitMRjJEM25Zb2owQ2FVN3V1WEFsVTR1WlpQSWxkMVdlamxFUjdT?= =?utf-8?B?a2lxUk5OQ0lBS3c1bUM5RHcydUVqYjdsRFhBZ200MG40Y1F6bjJhdDBJMTlt?= =?utf-8?B?VmFZZzhQdE50R1BxN2ZpV0dENFFxVzErTk8zOGR3SUpLWW00MGNiNU9TTVI2?= =?utf-8?B?N1FyVGlnR3RXckZMZkRDZnVRTUZuYkRETGVPS2hjM2hWSDZqeUJhakJ5S2J6?= =?utf-8?B?cTM0WDc1QzhLUlgvUmp3RmNGd1dLTUdxL1RsT3ZBRWV3ZmxxRmFOMTF4Vjls?= =?utf-8?B?UUhUVjhSblJEZG1HZko2ZS90cUVRYklYc1E5eUpydXFmV1VuTVZsT2pJNW1a?= =?utf-8?B?dmVKSmlJbHVBa203aUVIUzlmNU5hOWlhUHZ6emNtZkJqcHNxZFdRaVFOTXV1?= =?utf-8?B?Y1dTalF3UVJTdEdwalhwV2VQSE82WW9IS0dPVTlYK1FkKzVKd0pUNWEvRzFH?= =?utf-8?B?VEhjT1V3ZzB2a0xienprNjVEMDRiSm10OUtoa2ZsMjE4K3ZkcHZuZVlaSFRY?= =?utf-8?B?Q1pXcTNTQXdaUys4blVlZlZtOFRIMUU4ZzN4enhMWTQ1VUN1dHRKZ210bVJ2?= =?utf-8?Q?atvb2dV2OiOQb6TIcmRaoA4=3D?=
X-MS-Exchange-SenderADCheck: 1
X-Microsoft-Antispam-Message-Info: px2Pj9/Xuh3Gnosvd+K79B0yir9mY4p26d5R817tD7kqsMxfOJwxZj6EAgbrfbt4KRp0RDcEjJmzRZjOBS43Zs7dX/1CRj1YpYqfLuyz35hsEYhmTIHgAyL+WPzENA9MEB9oZG1G9gNxzE6rh4wZFXFofEKakcsc1JaMgztChmlnQ0xOpyZ3dfaHxI7jLszb05CBI9J9aaJKPJ8dUSA7hCA0XXNzQGQAO3doETDufavmL0Q6OpJzTY9/pcpTYedWPjVntPSzVoqRKQiqP7xCx0rsenNJRYXV6MKjwrvrzFQSHE6lDlgert4AdH3Nn9xseRbcsWnD9zM3jVdR/I8Caeh+bGoPVaBm7Y3wAbI5ZJ0g+OgwZp3LMyW6lUtiGGEECCsqtUk2jKSbPgkjcWBR68q3GL5u/oq/4hA7CXOydak=
X-Microsoft-Exchange-Diagnostics: 1; AM5P189MB0323; 6:lrJ719gTjSzXxLJJU7qYUiSDIqtNWGg29yLNzllG4zeQOH26Annrpi1SyXwjyF7Da4c7E+z0Z21a9I2YmXzBt3qoifoFfjnICen1kPYCi4sQcHcNW9vNL3VuJTZiikvsF7wiSENEAcBxYe5X3cb2nS6cHu6AnFAr38KSKd79dbGlQr7wyMi4mGDZfskpCik4vX6msy+IdlyNHWKYGe1D8sGPSyrcnIGRA7K6vhNwa22jzQnY4hM8nOee5JPQwhNN1wtsT22DVIqnSsB5EYrNwtpRu9EChF6uEJAKUOTw9alQEAjgyySIjNaVBis6ABxAE7NZn3GM28YgozjDq4lxb9BprIFm2csVJHWGEw1NAPZ7RPf90uWykUTYK1963dPwoepxmV7AMR6525OZxpbFLw5Rjjfd4NREtn4y+fbnU0C8k2y8KmpSPcT0TM2CKiSXq3h5xNIvK+2mnTyBzKVW9Q==; 5:iRT1qlVT1ETlnTtof/hMbk90OqZsbMZT7t2vntzEU4pfcPvo0OaYtqYgkwgLJdyipo6q1myCF3+Jn/vGafbxqeklFoLoL30OtpwGNKLEJUpEEjklp1ZERI8LIByEDwXuxrqBxQAJ1mjelvHW7/lgvusfv+DwRhAiSrjRUeCquTJKBXgN0p1PAnwt0dso3bGs89+TZiesMdfxmTuyMqA+1Q==; 7:5+VcBUHywtk2xuGO+7ynwWdQWun5OU618qHSUHkkOzGxsnxHYJeIR+mqsp/E80ZYwDfDpr12uEdNIAx6AoZhwfLg7hsDycRbZS7Pacxta/Zp/FaEkrAjrt2LJLjx3RA0+t52lTZ3JNjI4La9OIWUFw==
X-OriginatorOrg: ri.se
X-MS-Exchange-CrossTenant-OriginalArrivalTime: 31 Jan 2019 15:47:03.8739 (UTC)
X-MS-Exchange-CrossTenant-Network-Message-Id: f24f15c0-9ccc-4d42-292e-08d6879358de
X-MS-Exchange-CrossTenant-Id: 5a9809cf-0bcb-413a-838a-09ecc40cc9e8
X-MS-Exchange-CrossTenant-OriginalAttributedTenantConnectingIp: TenantId=5a9809cf-0bcb-413a-838a-09ecc40cc9e8; Ip=[194.218.146.197];  Helo=[mail.ri.se]
X-MS-Exchange-CrossTenant-FromEntityHeader: HybridOnPrem
X-MS-Exchange-Transport-CrossTenantHeadersStamped: AM5P189MB0323
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/9ZdHi82b2pNtl4pum4dc8jHkqoc>
Subject: Re: [xml2rfc] The bibxml entry of RFC 8516 creates an error with xml2rfc
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Fri, 01 Feb 2019 11:24:17 -0000

On 31/01/2019 16:31, Henrik Levkowetz wrote:
> Hi Ludwig,
> 
> On 2019-01-31 15:05, Ludwig Seitz wrote:
>> On 31/01/2019 14:13, Carsten Bormann wrote:
>>
>>> Something appears to be really broken on your side.  How does “ä” (which is &#228;) turn into &#258;[currency units]?
>>>
>>
>> More data:
>>
>> I'm also using xml2rfc version 2.5.1 on a Ubuntu 18.04 machine. I can
>> reproduce the error (even after manually deleting the cache file).
> 
> Version 2.5.1 is quite old (released 19 Oct 2015) and a lot has happened
> since then with respect to non-ascii support.  I'd suggest upgrading to
> a newer version through 'pip install'.  If the 2.5.1 release had the --utf8
> switch, you could try to do a run with that switch specified to get around
> the immediate issue.  But even if that works, upgrading to a newer version
> seems advisable.
> 
> 
> Regards
> 
> 	Henrik
> 
> 
> 

"pip install xml2rfc" gives me version 2.5.1 on Ubuntu 18.04.

/Ludwig

-- 
Ludwig Seitz, PhD
Security Lab, RISE
Phone +46(0)70-349 92 51


From nobody Fri Feb  1 03:35:31 2019
Return-Path: <ari.keranen@ericsson.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 91738131072 for <xml2rfc@ietfa.amsl.com>; Fri,  1 Feb 2019 03:35:29 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -7.873
X-Spam-Level: 
X-Spam-Status: No, score=-7.873 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIMWL_WL_HIGH=-4.553, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, FROM_EXCESS_BASE64=0.979, HTML_MESSAGE=0.001, RCVD_IN_DNSWL_MED=-2.3, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (1024-bit key) header.d=ericsson.com header.b=P1ycB5+m; dkim=pass (1024-bit key) header.d=ericsson.com header.b=jvtp6Rto
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id Hwsfpby8Yn0z for <xml2rfc@ietfa.amsl.com>; Fri,  1 Feb 2019 03:35:27 -0800 (PST)
Received: from sessmg22.ericsson.net (sessmg22.ericsson.net [193.180.251.58]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 1FA3C127B4C for <xml2rfc@ietf.org>; Fri,  1 Feb 2019 03:35:26 -0800 (PST)
DKIM-Signature: v=1; a=rsa-sha256; d=ericsson.com; s=mailgw201801; c=relaxed/relaxed;  q=dns/txt; i=@ericsson.com; t=1549020925; x=1551612925; h=From:Sender:Reply-To:Subject:Date:Message-ID:To:CC:MIME-Version:Content-Type: Content-Transfer-Encoding:Content-ID:Content-Description:Resent-Date:Resent-From: Resent-Sender:Resent-To:Resent-Cc:Resent-Message-ID:In-Reply-To:References:List-Id: List-Help:List-Unsubscribe:List-Subscribe:List-Post:List-Owner:List-Archive; bh=Tdo23GDs1Akp8s7/DeAcyG3+kn7YrcEe6yDW9RKqzGM=; b=P1ycB5+moqr40ECQSN3uxEOC5Equ0a5kfbuv2o0flbbFvAwVtM5YhhF7sH4I93tJ kCBmUFaipb7I6hbA1RHB8BUuJhsL2XvwtfbDlnSg3PG946AxgBUxaYHmlgZrMVHP 2QIZn0/gXYnw9hpJBwI9tU8lyaAnps9xcK5Zh4lrGCE=;
X-AuditID: c1b4fb3a-14fff7000000672c-36-5c542efde7d5
Received: from ESESSMB504.ericsson.se (Unknown_Domain [153.88.183.122]) by sessmg22.ericsson.net (Symantec Mail Security) with SMTP id 74.98.26412.DFE245C5; Fri,  1 Feb 2019 12:35:25 +0100 (CET)
Received: from ESESSMR502.ericsson.se (153.88.183.110) by ESESSMB504.ericsson.se (153.88.183.192) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256_P256) id 15.1.1466.3; Fri, 1 Feb 2019 12:35:24 +0100
Received: from ESESBMB501.ericsson.se (153.88.183.168) by ESESSMR502.ericsson.se (153.88.183.110) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256_P256) id 15.1.1466.3; Fri, 1 Feb 2019 12:35:24 +0100
Received: from EUR04-DB3-obe.outbound.protection.outlook.com (153.88.183.157) by ESESBMB501.ericsson.se (153.88.183.168) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_128_CBC_SHA256_P256) id 15.1.1466.3 via Frontend Transport; Fri, 1 Feb 2019 12:35:24 +0100
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=ericsson.com; s=selector1; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck; bh=Tdo23GDs1Akp8s7/DeAcyG3+kn7YrcEe6yDW9RKqzGM=; b=jvtp6Rtoj1mXQtB4SWI6gp+3hFcWqjxIrBaSzqPzHYEusSLvNicKkNb3IwNfPxuqNcM6qOmQCXOCR4Swmy6RjcZOu1wY3A6ZoTs4iuS0gKsgu+fjjfAx6DrpM4svSqhb3cfWpjKn9/K21zwIT5qnLfv0c+di87Bok+C1K+9aW+k=
Received: from HE1PR07MB4236.eurprd07.prod.outlook.com (20.176.166.145) by HE1PR07MB4202.eurprd07.prod.outlook.com (20.176.166.31) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.1580.15; Fri, 1 Feb 2019 11:35:23 +0000
Received: from HE1PR07MB4236.eurprd07.prod.outlook.com ([fe80::15e:bce2:76f6:7b9b]) by HE1PR07MB4236.eurprd07.prod.outlook.com ([fe80::15e:bce2:76f6:7b9b%6]) with mapi id 15.20.1601.011; Fri, 1 Feb 2019 11:35:23 +0000
From: =?utf-8?B?QXJpIEtlcsOkbmVu?= <ari.keranen@ericsson.com>
To: Carsten Bormann <cabo@tzi.org>, Ludwig Seitz <ludwig.seitz@ri.se>
CC: XML2RFC Interest Group <xml2rfc@ietf.org>
Thread-Topic: [xml2rfc] The bibxml entry of RFC 8516 creates an error with xml2rfc
Thread-Index: AQHUuWbi7unhUPcWzkKRap0+rIeo5aXK0aAA
Date: Fri, 1 Feb 2019 11:35:23 +0000
Message-ID: <7DF630AD-51BF-46D4-9636-0344692C73C7@ericsson.com>
References: <50228553-c0fe-c199-e3dc-452a381c5c64@ri.se> <86BE97C4-96C9-429D-8D5F-805B4F21FA74@tzi.org>
In-Reply-To: <86BE97C4-96C9-429D-8D5F-805B4F21FA74@tzi.org>
Accept-Language: en-US
Content-Language: en-US
X-MS-Has-Attach: 
X-MS-TNEF-Correlator: 
authentication-results: spf=none (sender IP is ) smtp.mailfrom=ari.keranen@ericsson.com; 
x-originating-ip: [89.166.49.243]
x-ms-publictraffictype: Email
x-microsoft-exchange-diagnostics: 1; HE1PR07MB4202; 6:OepEl5dwZsh8xi/iciBDQr0cFAcga/eA80XAgMvq9a+HuoZxte4BHLprhflXFo5BDqThrGUBXO9yuNwiKyU3VIbiFp/Om41iXPNB90uRqg7cvqnPShT4maj7TkrPekmghYUoQkkTM/pogbOADnt4tVrs8TsmzLgQpbZa/cSsFHB2VVlRkGvdHbWmpITLJNsxKlvODM4swvj0e1h3LBmViAM7WJDzTroZbMhulUqaDh3l7SiN0eQksKNL/DbJLEFNWXZpdABbd03tQGRzyFepLit44yRm51yzPrcXNqL7BPzJ/SnWTXqRtY0tuzVLf7FY05nKcfjPXoebX8LO5bAuFkmPA18cVHFAaSLpHxBkuTjmHA7pEQq2KdxGqA0UwnzfF8EahpE5Vcm+THo+ZyIgbhzMbhpHDZfaywVHDHwJUCIvz8EU9ryhiJXX82ZvDsp2HGE52bHb7umeMUXAoJTTCg==; 5:MPUqNEw1eQ4QlgdQRyAUckdpmOKe/H+OPTLvVHQneZmu+tnA+sIi/nbp0fE+SQEfajp6iOOAbQ1JbV02ZnVJGd/jCNNsLv+hge0GXHdxyVnHk5XSV1yU5Vh9X5URMEYIUGp7vtGKgSCVo5ImnOAebC+Q0hJYFIoYwG7DraCxPzAssRe7VCE4R7Azbk6E/EgQalRsnCKm+VJKXEPkyHR2MA==; 7:xE2oOd0qHn7eTg7yBLHh8zAP92ifBQP1rD92NQyINARoczlcHMKpOZ2+rYTGRWbFmFEmmCqOtW6UFyrmAzrGoELpci2oXVdFrw1OGV4+AKLuArwvRYDGYb81kveSh/XDX6zJ9UijbqmGTFlkRTV+bA==
x-ms-office365-filtering-correlation-id: 0147db13-0147-490a-4cef-08d688395abb
x-microsoft-antispam: BCL:0; PCL:0; RULEID:(2390118)(7020095)(4652040)(8989299)(4534185)(4627221)(201703031133081)(201702281549075)(8990200)(5600110)(711020)(4605077)(2017052603328)(7153060)(7193020); SRVR:HE1PR07MB4202; 
x-ms-traffictypediagnostic: HE1PR07MB4202:
x-microsoft-antispam-prvs: <HE1PR07MB4202DAFE106C1199D365B1D585920@HE1PR07MB4202.eurprd07.prod.outlook.com>
x-forefront-prvs: 09352FD734
x-forefront-antispam-report: SFV:NSPM; SFS:(10009020)(366004)(346002)(136003)(376002)(39860400002)(396003)(199004)(189003)(229853002)(81166006)(478600001)(14454004)(71190400001)(66066001)(6246003)(256004)(68736007)(2906002)(97736004)(71200400001)(83716004)(7736002)(4326008)(86362001)(8936002)(8676002)(110136005)(53936002)(25786009)(316002)(81156014)(6486002)(82746002)(3846002)(6512007)(105586002)(4744005)(106356001)(85202003)(36756003)(54896002)(236005)(6116002)(85182001)(186003)(26005)(6506007)(76176011)(99286004)(345774005)(102836004)(6436002)(33656002)(486006)(446003)(476003)(11346002)(2616005); DIR:OUT; SFP:1101; SCL:1; SRVR:HE1PR07MB4202; H:HE1PR07MB4236.eurprd07.prod.outlook.com; FPR:; SPF:None; LANG:en; PTR:InfoNoRecords; A:1; MX:1; 
received-spf: None (protection.outlook.com: ericsson.com does not designate permitted sender hosts)
x-ms-exchange-senderadcheck: 1
x-microsoft-antispam-message-info: FlWfCtmtw0r5bHx8H4GaFkC351JjIKa0NYrIKW7/XHx0U4Uvhcl+aeLoadR2akzZ6iQpgZ7MTZP3tccUwZe87rCZHZZAGKx1PaC9tLostuEAKf+73USGSDrbiuPmpmoKu45iQpZx4TP0iawxsCMcESMp2Mt3mmdLoIplkl1B5Rl8Ukk0Z8LT70ae+39g1D/xUuXxsyrDTCHE9p5ev+z9zszuhVRZFbmtklghhOVNuhwrl5dhcLhXjdJR3WMKRxSwa8N+Cjc3lGLNt4mrWaypA9jSr53C4fOofccORB4OPY3O77Fr9HFKmypu4ANN/RHK76rYjW9ETweodwTQ/XoiE/BFiiLTvEWIziU/KBlVCO9btSBV6yBejbBBZgAq4XeLNHq4cxCS+lG5gfiX8+NRO024jElTmGneSVyFdU93CZM=
Content-Type: multipart/alternative; boundary="_000_7DF630AD51BF46D496360344692C73C7ericssoncom_"
MIME-Version: 1.0
X-MS-Exchange-CrossTenant-Network-Message-Id: 0147db13-0147-490a-4cef-08d688395abb
X-MS-Exchange-CrossTenant-originalarrivaltime: 01 Feb 2019 11:35:23.4330 (UTC)
X-MS-Exchange-CrossTenant-fromentityheader: Hosted
X-MS-Exchange-CrossTenant-id: 92e84ceb-fbfd-47ab-be52-080c6b87953f
X-MS-Exchange-CrossTenant-mailboxtype: HOSTED
X-MS-Exchange-Transport-CrossTenantHeadersStamped: HE1PR07MB4202
X-OriginatorOrg: ericsson.com
X-Brightmail-Tracker: H4sIAAAAAAAAA02SbUhTURjHOffuuutodZxvD1qQww8mqWlRw7QSKgQRJf0QNdKlF7ec03ZN nASJpaYz1BTTkc50QbjCUmMiJjm0dLQKaYXmsKFRmW+VoZZKbneB337nPL//ec55ODQp6qUC aIUqn1GrZEqxh4DXdNZUFLYRnio9MNdPSYbq7ZRk9tcdSjKviztBxhsMa0T8/ZJuIr6hTZFM nhPEZDJKRQGjjjiWLpA/HzeivIaDhfOPuqli9CGyEnnSgA/BStUtqhIJaBEeQqDd0FLOggj/ RvD6xxGusMW3l16R3KKdgM/N3TzngodrSNg0WxEXqSPAVnuN4ykE1hEfJ3vgWJgpHXAd64NP Qd26iahENE3iMNA2BjrRG6dA18ddnJEKVls7wXEUDOuXXczDwfBprJ/v1IX4OPT1neYaKWDp ZxvPyZ74KPyxt7kaIewHK5aHriiJ/WFiRk9wD8Zg6H9DcuwL36Y33f55mLWM8rn9ILAuONz+ HhjTaxHHJXy46cAcJ8JyyyhyTgHwOILv+jF3OBR6qozucDZM13W5w7uhd9XudhwUjCxG16Aw 3bb7cZwB9XPtpJOF2AtGm2Z4Otew9kFnXwSnBEG91sHnOARK7za7OR5sreXEdqcV0R3Il2VY NicrKiqcUSsyWDZXFa5i8rvQ1n8a7Pkb3YsGv8SZEaaReIew70GKVETJClhNjhkBTYp9hK0B qVKRMFOmKWLUuWnqK0qGNaNAmif2F66LvKQinCXLZ7IZJo9R/68StGdAMcpKsGxmqldLL1je +XpXPF0LqL1xsrqjxZjOv5h2fdEwF6FLt8rXEu3KjqTHeyWxvaZq672hqVqPtfr3A47LBZ2T hsKYl3HRYvnwuilYo6icrJp4ctVYMnipzBaiTPpq2ukXPXUYv0126MtjNQmGhTNlMc+EixVL Pd4S6X7Di0Yxj5XLIkNJNSv7B1t9MpBLAwAA
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/2aXTLAgXs1Z3BNbJfUGj9reN8x0>
Subject: Re: [xml2rfc] The bibxml entry of RFC 8516 creates an error with xml2rfc
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Fri, 01 Feb 2019 11:35:30 -0000

--_000_7DF630AD51BF46D496360344692C73C7ericssoncom_
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: base64

DQoNCk9uIDMxIEphbiAyMDE5LCBhdCAxNS4xMywgQ2Fyc3RlbiBCb3JtYW5uIDxjYWJvQHR6aS5v
cmc8bWFpbHRvOmNhYm9AdHppLm9yZz4+IHdyb3RlOg0KDQoNCkFyaSBLZXLDpG5lbiByZWFsbHkg
ZG9lc27igJl0IG5lZWQgYWxsIHRob3NlIHBlc2t5IHVtbGF1dHMgOy0pDQoNCknigJlsbCBsZXQg
QXJpIGRlY2lkZSB0aGF0IDotKQ0KDQpIZWgsIGFzIEkgbWVudGlvbmVkIHRvIEx1ZHdpZyBpbiBh
bm90aGVyIHRocmVhZCwgSSBhY3R1YWxseSB1c2VkIG15IHByb3BlciBsw6RzdCBuYW1lIHdoZW4g
SSBzdGFydGVkIGF0IHRoZSBJRVRGICsxMCB5ZWFycyBhZ28gYnV0IHJ1biBpbnRvIHNvIG1hbnkg
cHJvYmxlbXMgdGhhdCBJIHN0b3BwZWQgcHJldHR5IGZhc3QuIEFmdGVyIHRoYXQgSSd2ZSBiZWVu
IGNhcmVmdWwgdG8gdXNlIHRoZSB2ZXJzaW9uIHdpdGhvdXQgZXh0ZW5kZWQgQVNDSUkgaW4gYWxs
IG15IGRyYWZ0cywgYnV0IHNlZW1zIHRoYXQgSUVURiB0b29scyBub3cgc29tZWhvdyBmaWd1cmVk
IG91dCBteSByZWFsIGxhc3QgbmFtZS4NCg0KSSd2ZSBiZWVuIHByZXR0eSBoYXBweSBzbyBmYXIg
d2l0aCBteSBuYW1lIHdpdGhvdXQgdGhvc2UgdW1sYXV0cywgYnV0IGlmIHdlIGNhbiBnZXQgdGhp
cyBmaW5hbGx5IGZpeGVkLCB0aGF0J2QgYmUgZ3JlYXQhDQoNCkFzIGRpc2N1c3NlZCBsYXRlciBp
biB0aGUgdGhyZWFkLCBzb21lIHRvb2xzIHR1cm4gIsOkIiBpbnRvICJhZSIuIElNSE8sIHRoYXQg
d291bGQgYmUgdGhlIHdvcnN0IG9wdGlvbiBvdXQgb2YgdGhlIHRocmVlLiBTbyBJIG11Y2ggcmF0
aGVyIHVzZSBLZXJhbmVuIHRoYW4gdGhhdC4NCg0KVGhhbmsgeW91IGZvciB0YWtpbmcgdGhlIGVm
Zm9ydCB0byBoZWxwIGZpeGluZyB0aGlzIQ0KDQoNCkNoZWVycywNCkFyaQ0K

--_000_7DF630AD51BF46D496360344692C73C7ericssoncom_
Content-Type: text/html; charset="utf-8"
Content-ID: <A941505B92F82B4C9CBCFD23EF4918E1@eurprd07.prod.outlook.com>
Content-Transfer-Encoding: base64

PGh0bWw+DQo8aGVhZD4NCjxtZXRhIGh0dHAtZXF1aXY9IkNvbnRlbnQtVHlwZSIgY29udGVudD0i
dGV4dC9odG1sOyBjaGFyc2V0PXV0Zi04Ij4NCjwvaGVhZD4NCjxib2R5IHN0eWxlPSJ3b3JkLXdy
YXA6IGJyZWFrLXdvcmQ7IC13ZWJraXQtbmJzcC1tb2RlOiBzcGFjZTsgbGluZS1icmVhazogYWZ0
ZXItd2hpdGUtc3BhY2U7IiBjbGFzcz0iIj4NCjxiciBjbGFzcz0iIj4NCjxkaXY+PGJyIGNsYXNz
PSIiPg0KPGJsb2NrcXVvdGUgdHlwZT0iY2l0ZSIgY2xhc3M9IiI+DQo8ZGl2IGNsYXNzPSIiPk9u
IDMxIEphbiAyMDE5LCBhdCAxNS4xMywgQ2Fyc3RlbiBCb3JtYW5uICZsdDs8YSBocmVmPSJtYWls
dG86Y2Fib0B0emkub3JnIiBjbGFzcz0iIj5jYWJvQHR6aS5vcmc8L2E+Jmd0OyB3cm90ZTo8L2Rp
dj4NCjxiciBjbGFzcz0iQXBwbGUtaW50ZXJjaGFuZ2UtbmV3bGluZSI+DQo8ZGl2IGNsYXNzPSIi
Pg0KPGJsb2NrcXVvdGUgdHlwZT0iY2l0ZSIgc3R5bGU9ImZvbnQtZmFtaWx5OiBNZW5sby1SZWd1
bGFyOyBmb250LXNpemU6IDEzcHg7IGZvbnQtc3R5bGU6IG5vcm1hbDsgZm9udC12YXJpYW50LWNh
cHM6IG5vcm1hbDsgZm9udC13ZWlnaHQ6IG5vcm1hbDsgbGV0dGVyLXNwYWNpbmc6IG5vcm1hbDsg
b3JwaGFuczogYXV0bzsgdGV4dC1hbGlnbjogc3RhcnQ7IHRleHQtaW5kZW50OiAwcHg7IHRleHQt
dHJhbnNmb3JtOiBub25lOyB3aGl0ZS1zcGFjZTogbm9ybWFsOyB3aWRvd3M6IGF1dG87IHdvcmQt
c3BhY2luZzogMHB4OyAtd2Via2l0LXRleHQtc2l6ZS1hZGp1c3Q6IGF1dG87IC13ZWJraXQtdGV4
dC1zdHJva2Utd2lkdGg6IDBweDsgdGV4dC1kZWNvcmF0aW9uOiBub25lOyIgY2xhc3M9IiI+DQo8
YnIgY2xhc3M9IkFwcGxlLWludGVyY2hhbmdlLW5ld2xpbmUiPg0KQXJpIEtlcsOkbmVuIHJlYWxs
eSBkb2VzbuKAmXQgbmVlZCBhbGwgdGhvc2UgcGVza3kgdW1sYXV0cyA7LSk8YnIgY2xhc3M9IiI+
DQo8L2Jsb2NrcXVvdGU+DQo8YnIgc3R5bGU9ImNhcmV0LWNvbG9yOiByZ2IoMCwgMCwgMCk7IGZv
bnQtZmFtaWx5OiBNZW5sby1SZWd1bGFyOyBmb250LXNpemU6IDEzcHg7IGZvbnQtc3R5bGU6IG5v
cm1hbDsgZm9udC12YXJpYW50LWNhcHM6IG5vcm1hbDsgZm9udC13ZWlnaHQ6IG5vcm1hbDsgbGV0
dGVyLXNwYWNpbmc6IG5vcm1hbDsgdGV4dC1hbGlnbjogc3RhcnQ7IHRleHQtaW5kZW50OiAwcHg7
IHRleHQtdHJhbnNmb3JtOiBub25lOyB3aGl0ZS1zcGFjZTogbm9ybWFsOyB3b3JkLXNwYWNpbmc6
IDBweDsgLXdlYmtpdC10ZXh0LXN0cm9rZS13aWR0aDogMHB4OyB0ZXh0LWRlY29yYXRpb246IG5v
bmU7IiBjbGFzcz0iIj4NCjxzcGFuIHN0eWxlPSJjYXJldC1jb2xvcjogcmdiKDAsIDAsIDApOyBm
b250LWZhbWlseTogTWVubG8tUmVndWxhcjsgZm9udC1zaXplOiAxM3B4OyBmb250LXN0eWxlOiBu
b3JtYWw7IGZvbnQtdmFyaWFudC1jYXBzOiBub3JtYWw7IGZvbnQtd2VpZ2h0OiBub3JtYWw7IGxl
dHRlci1zcGFjaW5nOiBub3JtYWw7IHRleHQtYWxpZ246IHN0YXJ0OyB0ZXh0LWluZGVudDogMHB4
OyB0ZXh0LXRyYW5zZm9ybTogbm9uZTsgd2hpdGUtc3BhY2U6IG5vcm1hbDsgd29yZC1zcGFjaW5n
OiAwcHg7IC13ZWJraXQtdGV4dC1zdHJva2Utd2lkdGg6IDBweDsgdGV4dC1kZWNvcmF0aW9uOiBu
b25lOyBmbG9hdDogbm9uZTsgZGlzcGxheTogaW5saW5lICFpbXBvcnRhbnQ7IiBjbGFzcz0iIj5J
4oCZbGwNCiBsZXQgQXJpIGRlY2lkZSB0aGF0IDotKTwvc3Bhbj48L2Rpdj4NCjwvYmxvY2txdW90
ZT4NCjwvZGl2Pg0KPGJyIGNsYXNzPSIiPg0KPGRpdiBjbGFzcz0iIj5IZWgsIGFzIEkgbWVudGlv
bmVkIHRvIEx1ZHdpZyBpbiBhbm90aGVyIHRocmVhZCw8c3BhbiBzdHlsZT0iZm9udC1mYW1pbHk6
IE1lbmxvLVJlZ3VsYXI7IiBjbGFzcz0iIj4mbmJzcDs8L3NwYW4+PHNwYW4gc3R5bGU9ImZvbnQt
ZmFtaWx5OiBNZW5sby1SZWd1bGFyOyIgY2xhc3M9IiI+SSBhY3R1YWxseSB1c2VkIG15IHByb3Bl
ciBsw6RzdCBuYW1lIHdoZW4gSSBzdGFydGVkIGF0IHRoZSBJRVRGICYjNDM7MTAgeWVhcnMgYWdv
IGJ1dCBydW4NCiBpbnRvIHNvIG1hbnkgcHJvYmxlbXMgdGhhdCBJIHN0b3BwZWQgcHJldHR5IGZh
c3QuIEFmdGVyIHRoYXQgSSd2ZSBiZWVuIGNhcmVmdWwgdG8gdXNlIHRoZSB2ZXJzaW9uIHdpdGhv
dXQgZXh0ZW5kZWQgQVNDSUkgaW4gYWxsIG15IGRyYWZ0cywgYnV0IHNlZW1zIHRoYXQgSUVURiB0
b29scyBub3cgc29tZWhvdyBmaWd1cmVkIG91dCBteSByZWFsIGxhc3QgbmFtZS48L3NwYW4+PHNw
YW4gc3R5bGU9ImZvbnQtZmFtaWx5OiBNZW5sby1SZWd1bGFyOyIgY2xhc3M9IiI+Jm5ic3A7PC9z
cGFuPjwvZGl2Pg0KPGRpdiBjbGFzcz0iIj48c3BhbiBzdHlsZT0iZm9udC1mYW1pbHk6IE1lbmxv
LVJlZ3VsYXI7IiBjbGFzcz0iIj48YnIgY2xhc3M9IiI+DQo8L3NwYW4+PC9kaXY+DQo8ZGl2IGNs
YXNzPSIiPjxmb250IGZhY2U9Ik1lbmxvLVJlZ3VsYXIiIGNsYXNzPSIiPkkndmUgYmVlbiBwcmV0
dHkgaGFwcHkgc28gZmFyIHdpdGggbXkgbmFtZSB3aXRob3V0IHRob3NlIHVtbGF1dHMsIGJ1dCBp
ZiB3ZSBjYW4gZ2V0IHRoaXMgZmluYWxseSBmaXhlZCwgdGhhdCdkIGJlIGdyZWF0ISZuYnNwOzwv
Zm9udD48L2Rpdj4NCjxkaXYgY2xhc3M9IiI+PGZvbnQgZmFjZT0iTWVubG8tUmVndWxhciIgY2xh
c3M9IiI+PGJyIGNsYXNzPSIiPg0KPC9mb250PjwvZGl2Pg0KPGRpdiBjbGFzcz0iIj48Zm9udCBm
YWNlPSJNZW5sby1SZWd1bGFyIiBjbGFzcz0iIj5BcyBkaXNjdXNzZWQgbGF0ZXIgaW4gdGhlIHRo
cmVhZCwgc29tZSB0b29scyB0dXJuICZxdW90O8OkJnF1b3Q7IGludG8gJnF1b3Q7YWUmcXVvdDsu
IElNSE8sIHRoYXQgd291bGQgYmUgdGhlIHdvcnN0IG9wdGlvbiBvdXQgb2YgdGhlIHRocmVlLiBT
byBJIG11Y2ggcmF0aGVyIHVzZSBLZXJhbmVuIHRoYW4gdGhhdC48L2ZvbnQ+PC9kaXY+DQo8ZGl2
IGNsYXNzPSIiPjxmb250IGZhY2U9Ik1lbmxvLVJlZ3VsYXIiIGNsYXNzPSIiPjxiciBjbGFzcz0i
Ij4NCjwvZm9udD48L2Rpdj4NCjxkaXYgY2xhc3M9IiI+PGZvbnQgZmFjZT0iTWVubG8tUmVndWxh
ciIgY2xhc3M9IiI+VGhhbmsgeW91IGZvciB0YWtpbmcgdGhlIGVmZm9ydCB0byBoZWxwIGZpeGlu
ZyB0aGlzITwvZm9udD48L2Rpdj4NCjxkaXYgY2xhc3M9IiI+PHNwYW4gc3R5bGU9ImZvbnQtZmFt
aWx5OiBNZW5sby1SZWd1bGFyOyIgY2xhc3M9IiI+PGJyIGNsYXNzPSIiPg0KPC9zcGFuPjwvZGl2
Pg0KPGRpdiBjbGFzcz0iIj48c3BhbiBzdHlsZT0iZm9udC1mYW1pbHk6IE1lbmxvLVJlZ3VsYXI7
IiBjbGFzcz0iIj48YnIgY2xhc3M9IiI+DQo8L3NwYW4+PC9kaXY+DQo8ZGl2IGNsYXNzPSIiPjxz
cGFuIHN0eWxlPSJmb250LWZhbWlseTogTWVubG8tUmVndWxhcjsiIGNsYXNzPSIiPkNoZWVyczwv
c3Bhbj48c3BhbiBzdHlsZT0iZm9udC1mYW1pbHk6IE1lbmxvLVJlZ3VsYXI7IiBjbGFzcz0iIj4s
PC9zcGFuPjwvZGl2Pg0KPGRpdiBjbGFzcz0iIj48c3BhbiBzdHlsZT0iZm9udC1mYW1pbHk6IE1l
bmxvLVJlZ3VsYXI7IiBjbGFzcz0iIj5Bcmk8L3NwYW4+PC9kaXY+DQo8L2JvZHk+DQo8L2h0bWw+
DQo=

--_000_7DF630AD51BF46D496360344692C73C7ericssoncom_--


From nobody Fri Feb  1 05:11:51 2019
Return-Path: <samuelmarks@gmail.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 77AC412DF72 for <xml2rfc@ietfa.amsl.com>; Fri,  1 Feb 2019 05:11:49 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.998
X-Spam-Level: 
X-Spam-Status: No, score=-1.998 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, FREEMAIL_FROM=0.001, HTML_MESSAGE=0.001, RCVD_IN_DNSWL_NONE=-0.0001, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (2048-bit key) header.d=gmail.com
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id VyKq_stUj0tR for <xml2rfc@ietfa.amsl.com>; Fri,  1 Feb 2019 05:11:47 -0800 (PST)
Received: from mail-it1-x130.google.com (mail-it1-x130.google.com [IPv6:2607:f8b0:4864:20::130]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 8E7CD127133 for <xml2rfc@ietf.org>; Fri,  1 Feb 2019 05:11:47 -0800 (PST)
Received: by mail-it1-x130.google.com with SMTP id z20so9665644itc.3 for <xml2rfc@ietf.org>; Fri, 01 Feb 2019 05:11:47 -0800 (PST)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025;  h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=g8AWHC92p1FaOlvHG8y4f6VhLu/GcMzZUqUbUTeRaIM=; b=kvNJNxDn+PEgccHNCQ6GDdT7aeKKuw77bxrIE9GfHQxoGn9CF26FDG5j5jc9VatT8Q yFSlJBFsCq4cWjQR/7VYxxCz30QnWzhMGcIxoof8q1EefHyeKhIh49eAEaskfGEMsJJh VALODeSNUP+QyQREcWQ3naTazbxJzMT8SlZ0HKb5u0XlBdQo4cHSE0EIS0KVQoiFCiK0 /Tf1HHNwXEEqNZMoiKR619sex8g52/z2tAZYw2YkhSeJztmjILmB1OeIptafNIGeFLJU Nv/pEhtGeRbYBh9XSUcNERnq4vOPgNwtINH/fDO7WYgVrqPv0Ve54HJ8coIeaJp6crtI QNAA==
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=g8AWHC92p1FaOlvHG8y4f6VhLu/GcMzZUqUbUTeRaIM=; b=YugwgTW3beri6WHj1NARfZuBoSm2nRHql5sU2FKYXo0X8JfxCB/9Gx8WZ1niKDf5cK IEIG4WvphmnT3TkYimfMDoV+ku/ycwfsyxSk7ojo3BD9gnnlMcqs7mG1KG7cnEkmMQZs VN2IovhqC88LmpAkDJ0cWDTLgIdVBBqv7q9LLlURF4RFHmn4q+6r+CKoj4nBvbU3quDK GqZepluGv4/pTtseWPi+RSlEa53w/GNL/rt6qSAD66qNKQ/+kSb7w1EvD4+paQHJR836 54hcHAWwOCHhUYoys1Waf727QVbTmV69aOqc9ltC/ZMdUj1SEvmj1EijauO+TVkMowuM vw/Q==
X-Gm-Message-State: AHQUAuYOPHVbQ2OwR518ytl5xgjdCxfZ6tFqL5RlFdfl4kVGLDZuS4rS rUJxV+gBxGOLrj1OdvDmX4ZCK2VY0GAJw7XgLVg=
X-Google-Smtp-Source: AHgI3IarEH9ArSHPycjq/67WKnjyVXvu/aR66AhDdZrgzzeF6Ar2JYwKqc8kqotHogtKxeppPhP5nK2jU+6VBUb3gzQ=
X-Received: by 2002:a05:660c:a8d:: with SMTP id m13mr1305697itk.73.1549026706781;  Fri, 01 Feb 2019 05:11:46 -0800 (PST)
MIME-Version: 1.0
References: <50228553-c0fe-c199-e3dc-452a381c5c64@ri.se> <86BE97C4-96C9-429D-8D5F-805B4F21FA74@tzi.org> <7DF630AD-51BF-46D4-9636-0344692C73C7@ericsson.com>
In-Reply-To: <7DF630AD-51BF-46D4-9636-0344692C73C7@ericsson.com>
From: Samuel Marks <samuelmarks@gmail.com>
Date: Sat, 2 Feb 2019 00:11:35 +1100
Message-ID: <CAMfPbcbuzagoTSK1mzkVbrPe=efCH8A4ygvupQNh7_evN-n_sQ@mail.gmail.com>
To: =?UTF-8?B?QXJpIEtlcsOkbmVu?= <ari.keranen@ericsson.com>
Cc: Carsten Bormann <cabo@tzi.org>, Ludwig Seitz <ludwig.seitz@ri.se>,  XML2RFC Interest Group <xml2rfc@ietf.org>
Content-Type: multipart/alternative; boundary="0000000000009afd380580d4e252"
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/nlAhKdyneBmA7p__WnYI4RmqlOo>
Subject: Re: [xml2rfc] The bibxml entry of RFC 8516 creates an error with xml2rfc
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Fri, 01 Feb 2019 13:11:49 -0000

--0000000000009afd380580d4e252
Content-Type: text/plain; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

Favourite thread on xml2rfc

+1

!!!!

On Fri, 1 Feb 2019 at 10:35 pm, Ari Ker=C3=A4nen <ari.keranen@ericsson.com>
wrote:

>
>
> On 31 Jan 2019, at 15.13, Carsten Bormann <cabo@tzi.org> wrote:
>
>
> Ari Ker=C3=A4nen really doesn=E2=80=99t need all those pesky umlauts ;-)
>
>
> I=E2=80=99ll let Ari decide that :-)
>
>
> Heh, as I mentioned to Ludwig in another thread, I actually used my
> proper l=C3=A4st name when I started at the IETF +10 years ago but run in=
to so
> many problems that I stopped pretty fast. After that I've been careful to
> use the version without extended ASCII in all my drafts, but seems that
> IETF tools now somehow figured out my real last name.
>
> I've been pretty happy so far with my name without those umlauts, but if
> we can get this finally fixed, that'd be great!
>
> As discussed later in the thread, some tools turn "=C3=A4" into "ae". IMH=
O,
> that would be the worst option out of the three. So I much rather use
> Keranen than that.
>
> Thank you for taking the effort to help fixing this!
>
>
> Cheers,
> Ari
> _______________________________________________
> xml2rfc mailing list
> xml2rfc@ietf.org
> https://www.ietf.org/mailman/listinfo/xml2rfc
>
--=20
Samuel Marks
http://linkedin.com/in/samuelmarks

--0000000000009afd380580d4e252
Content-Type: text/html; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

<div><div dir=3D"auto">Favourite thread on xml2rfc</div></div><div dir=3D"a=
uto"><br></div><div dir=3D"auto">+1</div><div dir=3D"auto"><br></div><div d=
ir=3D"auto">!!!!</div><div><br><div class=3D"gmail_quote"><div dir=3D"ltr">=
On Fri, 1 Feb 2019 at 10:35 pm, Ari Ker=C3=A4nen &lt;<a href=3D"mailto:ari.=
keranen@ericsson.com">ari.keranen@ericsson.com</a>&gt; wrote:<br></div><blo=
ckquote class=3D"gmail_quote" style=3D"margin:0 0 0 .8ex;border-left:1px #c=
cc solid;padding-left:1ex">



<div style=3D"word-wrap:break-word;line-break:after-white-space">
<br>
<div><br>
<blockquote type=3D"cite">
<div>On 31 Jan 2019, at 15.13, Carsten Bormann &lt;<a href=3D"mailto:cabo@t=
zi.org" target=3D"_blank">cabo@tzi.org</a>&gt; wrote:</div>
<br class=3D"m_1114062809439628842Apple-interchange-newline">
<div>
<blockquote type=3D"cite" style=3D"font-family:Menlo-Regular;font-size:13px=
;font-style:normal;font-variant-caps:normal;font-weight:normal;letter-spaci=
ng:normal;text-align:start;text-indent:0px;text-transform:none;white-space:=
normal;word-spacing:0px;text-decoration:none">
<br class=3D"m_1114062809439628842Apple-interchange-newline">
Ari Ker=C3=A4nen really doesn=E2=80=99t need all those pesky umlauts ;-)<br=
>
</blockquote>
<br style=3D"font-family:Menlo-Regular;font-size:13px;font-style:normal;fon=
t-variant-caps:normal;font-weight:normal;letter-spacing:normal;text-align:s=
tart;text-indent:0px;text-transform:none;white-space:normal;word-spacing:0p=
x;text-decoration:none">
<span style=3D"font-family:Menlo-Regular;font-size:13px;font-style:normal;f=
ont-variant-caps:normal;font-weight:normal;letter-spacing:normal;text-align=
:start;text-indent:0px;text-transform:none;white-space:normal;word-spacing:=
0px;text-decoration:none;float:none;display:inline!important">I=E2=80=99ll
 let Ari decide that :-)</span></div>
</blockquote>
</div>
<br>
<div>Heh, as I mentioned to Ludwig in another thread,<span style=3D"font-fa=
mily:Menlo-Regular">=C2=A0</span><span style=3D"font-family:Menlo-Regular">=
I actually used my proper l=C3=A4st name when I started at the IETF +10 yea=
rs ago but run
 into so many problems that I stopped pretty fast. After that I&#39;ve been=
 careful to use the version without extended ASCII in all my drafts, but se=
ems that IETF tools now somehow figured out my real last name.</span><span =
style=3D"font-family:Menlo-Regular">=C2=A0</span></div>
<div><span style=3D"font-family:Menlo-Regular"><br>
</span></div>
<div><font face=3D"Menlo-Regular">I&#39;ve been pretty happy so far with my=
 name without those umlauts, but if we can get this finally fixed, that&#39=
;d be great!=C2=A0</font></div>
<div><font face=3D"Menlo-Regular"><br>
</font></div>
<div><font face=3D"Menlo-Regular">As discussed later in the thread, some to=
ols turn &quot;=C3=A4&quot; into &quot;ae&quot;. IMHO, that would be the wo=
rst option out of the three. So I much rather use Keranen than that.</font>=
</div>
<div><font face=3D"Menlo-Regular"><br>
</font></div>
<div><font face=3D"Menlo-Regular">Thank you for taking the effort to help f=
ixing this!</font></div>
<div><span style=3D"font-family:Menlo-Regular"><br>
</span></div>
<div><span style=3D"font-family:Menlo-Regular"><br>
</span></div>
<div><span style=3D"font-family:Menlo-Regular">Cheers</span><span style=3D"=
font-family:Menlo-Regular">,</span></div>
<div><span style=3D"font-family:Menlo-Regular">Ari</span></div>
</div>

_______________________________________________<br>
xml2rfc mailing list<br>
<a href=3D"mailto:xml2rfc@ietf.org" target=3D"_blank">xml2rfc@ietf.org</a><=
br>
<a href=3D"https://www.ietf.org/mailman/listinfo/xml2rfc" rel=3D"noreferrer=
" target=3D"_blank">https://www.ietf.org/mailman/listinfo/xml2rfc</a><br>
</blockquote></div></div>-- <br><div dir=3D"ltr" class=3D"gmail_signature" =
data-smartmail=3D"gmail_signature">Samuel Marks<br><a href=3D"http://linked=
in.com/in/samuelmarks">http://linkedin.com/in/samuelmarks</a></div>

--0000000000009afd380580d4e252--


From nobody Fri Feb  1 07:56:00 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id CB0EE130E85 for <xml2rfc@ietfa.amsl.com>; Fri,  1 Feb 2019 07:55:59 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 3F3w_1vqbBYI for <xml2rfc@ietfa.amsl.com>; Fri,  1 Feb 2019 07:55:57 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id A52B5130E82 for <xml2rfc@ietf.org>; Fri,  1 Feb 2019 07:55:57 -0800 (PST)
Received: from localhost ([::1]:52752 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gpbAa-0002MP-IV; Fri, 01 Feb 2019 07:55:56 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Fri, 01 Feb 2019 15:55:56 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/390
Message-ID: <069.45749f014a9a9e539e1cd8580fc19d84@tools.ietf.org>
X-Trac-Ticket-ID: 390
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/ZDZEo0Fryp_sx9_LKu4375TBiYc>
Subject: [xml2rfc] #390 (Version_3_cli_txt): unhelpful diagnostics in v3 mode
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Fri, 01 Feb 2019 15:56:00 -0000

#390: unhelpful diagnostics in v3 mode

 Parsing file reference-group-test.xml
 Traceback (most recent call last):
   File "/bin/xml2rfc", line 11, in <module>
     sys.exit(main())
   File "/usr/lib/python3.6/site-packages/xml2rfc/run.py", line 548, in
 main
     writer.write(filename)
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 245, in write
     html_tree = self.html_tree()
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 222, in html_tree
     html_tree = self.render(None, self.root)
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 277, in render
     res = func(h, x)
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 536, in render_rfc
     self.render(body, c)
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 277, in render
     res = func(h, x)
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 291, in skip_renderer
     self.render(h, c)
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 277, in render
     res = func(h, x)
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 2048, in render_section
     self.render(section, c)
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 277, in render
     res = func(h, x)
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 958, in render_author
     address.insert(0, lxml.etree.Element('postal'))
 AttributeError: 'NoneType' object has no attribute 'insert'

-- 
-----------------------------------+--------------------
 Reporter:  julian.reschke@gmx.de  |      Owner:
     Type:  defect                 |     Status:  new
 Priority:  medium                 |  Milestone:
Component:  Version_3_cli_txt      |    Version:  2.17.*
 Keywords:                         |
-----------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/390>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Fri Feb  1 07:58:02 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 4D8C3130EBB for <xml2rfc@ietfa.amsl.com>; Fri,  1 Feb 2019 07:58:01 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id lB_oGaisd1Y8 for <xml2rfc@ietfa.amsl.com>; Fri,  1 Feb 2019 07:57:59 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 9A66D130EAE for <xml2rfc@ietf.org>; Fri,  1 Feb 2019 07:57:59 -0800 (PST)
Received: from localhost ([::1]:52816 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gpbCZ-0008O1-Ds; Fri, 01 Feb 2019 07:57:59 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Fri, 01 Feb 2019 15:57:59 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/390#comment:1
Message-ID: <084.5a5158a38dfc96f027e54d151a204ac8@tools.ietf.org>
References: <069.45749f014a9a9e539e1cd8580fc19d84@tools.ietf.org>
X-Trac-Ticket-ID: 390
In-Reply-To: <069.45749f014a9a9e539e1cd8580fc19d84@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/wB0NtViXTAdj9mfnzvGGsFoiGuI>
Subject: Re: [xml2rfc] #390 (Version_3_cli_txt): unhelpful diagnostics in v3 mode
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Fri, 01 Feb 2019 15:58:01 -0000

#390: unhelpful diagnostics in v3 mode


Comment (by julian.reschke@gmx.de):

 Seems <address> is considered required.

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_txt      |    Version:  2.17.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/390#comment:1>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Fri Feb  1 08:26:33 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id B2339130F83 for <xml2rfc@ietfa.amsl.com>; Fri,  1 Feb 2019 08:26:31 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id dq3qqKV68CMb for <xml2rfc@ietfa.amsl.com>; Fri,  1 Feb 2019 08:26:29 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id E1394130F7C for <xml2rfc@ietf.org>; Fri,  1 Feb 2019 08:26:29 -0800 (PST)
Received: from localhost ([::1]:53395 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gpbe9-0000a7-Az; Fri, 01 Feb 2019 08:26:29 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Fri, 01 Feb 2019 16:26:29 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/391
Message-ID: <069.4f76e5ff74bc807d4200e305e9957c6f@tools.ietf.org>
X-Trac-Ticket-ID: 391
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/ty9CHMPKXaGonWzXrxYCNfqsI2c>
Subject: [xml2rfc] #391 (Version_3_cli_txt): v3 html renderer broken for xref/@format="title" to references
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Fri, 01 Feb 2019 16:26:32 -0000

#391: v3 html renderer broken for xref/@format="title" to references

 Output:

 Reference to [RFC5234] (titled: "[Augmented BNF for Syntax Specifications:
 ABNF]").

 Should be:

 Reference to [RFC5234] (titled: "Augmented BNF for Syntax Specifications:
 ABNF").

 (the square brackets should not be there)

 Seems to be ok for text output.

-- 
-----------------------------------+--------------------
 Reporter:  julian.reschke@gmx.de  |      Owner:
     Type:  defect                 |     Status:  new
 Priority:  medium                 |  Milestone:
Component:  Version_3_cli_txt      |    Version:  2.17.*
 Keywords:                         |
-----------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/391>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Fri Feb  1 10:40:00 2019
Return-Path: <rfc-ed@rfc-editor.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id B4D4E131262 for <xml2rfc@ietfa.amsl.com>; Fri,  1 Feb 2019 10:39:50 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -4.2
X-Spam-Level: 
X-Spam-Status: No, score=-4.2 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_MED=-2.3, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id lWau9K7-snvF for <xml2rfc@ietfa.amsl.com>; Fri,  1 Feb 2019 10:39:48 -0800 (PST)
Received: from rfc-editor.org (rfc-editor.org [4.31.198.49]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 79201131261 for <xml2rfc@ietf.org>; Fri,  1 Feb 2019 10:39:48 -0800 (PST)
Received: by rfc-editor.org (Postfix, from userid 6000) id 684B9B82B54; Fri,  1 Feb 2019 10:39:46 -0800 (PST)
Date: Fri, 1 Feb 2019 10:39:46 -0800
From: RFC Editor <rfc-editor@rfc-editor.org>
To: Julian Reschke <julian.reschke@gmx.de>
Cc: XML2RFC Interest Group <xml2rfc@ietf.org>, Ari =?iso-8859-1?Q?Ker=E4nen?= <ari.keranen@ericsson.com>, Carsten Bormann <cabo@tzi.org>, Ludwig Seitz <ludwig.seitz@ri.se>
Message-ID: <20190201183946.GA19075@rfc-editor.org>
References: <403cf73e-3c08-e51c-830a-3c24c2df1dc7@gmx.de> <A44F6CC6-684F-4D59-8C15-6184B37FACA2@amsl.com>
MIME-Version: 1.0
Content-Type: text/plain; charset=utf-8
Content-Disposition: inline
Content-Transfer-Encoding: 8bit
In-Reply-To: <A44F6CC6-684F-4D59-8C15-6184B37FACA2@amsl.com>
User-Agent: Mutt/1.10.1 (2018-07-13)
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/ECBTAz5cjdfYbV61sfCgtDtk7Zg>
Subject: Re: [xml2rfc] Fwd: The bibxml entry of RFC 8516 creates an error with xml2rfc
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Fri, 01 Feb 2019 18:39:58 -0000

Greetings All,

Apologies, as our error caused this discussion. 

Our policy is for the names in the references to match what appears in
the document header.  We have updated our files.  

Thank you,
RFC Editor/sg

> > From: Julian Reschke <julian.reschke@gmx.de>
> > Subject: Re: [xml2rfc] The bibxml entry of RFC 8516 creates an error with xml2rfc
> > Date: January 31, 2019 at 6:29:59 AM PST
> > To: Carsten Bormann <cabo@tzi.org>, Ludwig Seitz <ludwig.seitz@ri.se>
> > Cc: XML2RFC Interest Group <xml2rfc@ietf.org>, Ari Keränen <ari.keranen@ericsson.com>
> > 
> > On 2019-01-31 14:13, Carsten Bormann wrote:
> >>> On Jan 31, 2019, at 13:35, Ludwig Seitz <ludwig.seitz@ri.se> wrote:
> >>> 
> >>> Hello list,
> >>> 
> >>> The bibxml entry for RFC 8516
> >>> (https://xml2rfc.tools.ietf.org/public/rfc/bibxml/reference.RFC.8516.xml)
> >>> 
> >>> contains umlauts, namely in this line:
> >>> <author initials="A." surname="Keränen" fullname="A. Keränen”>
> >> Nice to have real names in the bibxml now.
> >> ...
> > 
> > Not so sure about that, unless the tool chain (xml2rfc, idnits etc actually handle them properly.
> > 
> > Also, I would expect the bib entry to contain the name the same way it was spelled on the document, and that's not the case here:
> > 
> >> Internet Engineering Task Force (IETF)                        A. Keranen
> >> Request for Comments: 8516                                      Ericsson
> >> Category: Standards Track                                   January 2019
> >> ISSN: 2070-1721
> > 
> > 
> > 
> > 
> > Best regards, Julian
> > 
> > _______________________________________________
> > xml2rfc mailing list
> > xml2rfc@ietf.org
> > https://www.ietf.org/mailman/listinfo/xml2rfc
> 


From nobody Mon Feb  4 12:41:24 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 97DF7124B0C for <xml2rfc@ietfa.amsl.com>; Mon,  4 Feb 2019 12:41:22 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id NIZIkDGjnh8Y for <xml2rfc@ietfa.amsl.com>; Mon,  4 Feb 2019 12:41:20 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 815A91200D7 for <xml2rfc@ietf.org>; Mon,  4 Feb 2019 12:41:20 -0800 (PST)
Received: from localhost ([::1]:34394 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gql3O-0005k6-Mf; Mon, 04 Feb 2019 12:41:18 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, cabo@tzi.org
X-Trac-Project: xml2rfc
Date: Mon, 04 Feb 2019 20:41:18 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/392
Message-ID: <060.a75fce1ab1ed90ba9b52074db0d7ce99@tools.ietf.org>
X-Trac-Ticket-ID: 392
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, cabo@tzi.org, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/Ph4yD2UyVOTVywg91Z0sd-_zww0>
Subject: [xml2rfc] #392 (Version 2 cli): xml2rfc no longer works on Mac, apparently related to SVG processing
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 04 Feb 2019 20:41:23 -0000

#392: xml2rfc no longer works on Mac, apparently related to SVG processing

 Macs configured for standard weeks tend to have an ugly locale such as:

 {{{
  LANG="en_US@calendar=iso8601.UTF-8"
 }}}

 (Spare me the words about Apple hiding this necessary, should-be-default
 configuration in the locale.)

 xml2rfc now croaks with

 {{{
 Traceback (most recent call last):
   File "/Users/cabo/bin/xml2rfc", line 7, in <module>
     from xml2rfc.run import main
   File "/Users/cabo/lib/python3.7/site-packages/xml2rfc/__init__.py", line
 14, in <module>
     from xml2rfc.parser import  XmlRfcError, CachingResolver,
 XmlRfcParser, XmlRfc
   File "/Users/cabo/lib/python3.7/site-packages/xml2rfc/parser.py", line
 17, in <module>
     from xml2rfc.writers import base
   File "/Users/cabo/lib/python3.7/site-
 packages/xml2rfc/writers/__init__.py", line 14, in <module>
     from xml2rfc.writers.pdf import PdfWriter
   File "/Users/cabo/lib/python3.7/site-packages/xml2rfc/writers/pdf.py",
 line 15, in <module>
     import weasyprint
   File "/Users/cabo/lib/python3.7/site-packages/weasyprint/__init__.py",
 line 393, in <module>
     from .css import preprocess_stylesheet  # noqa
   File "/Users/cabo/lib/python3.7/site-
 packages/weasyprint/css/__init__.py", line 25, in <module>
     from . import computed_values
   File "/Users/cabo/lib/python3.7/site-
 packages/weasyprint/css/computed_values.py", line 21, in <module>
     from .utils import (
   File "/Users/cabo/lib/python3.7/site-packages/weasyprint/css/utils.py",
 line 20, in <module>
     from ..images import LinearGradient, RadialGradient
   File "/Users/cabo/lib/python3.7/site-packages/weasyprint/images.py",
 line 17, in <module>
     import cairosvg.parser
   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/__init__.py",
 line 41, in <module>
     from . import surface  # noqa
   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/surface.py", line
 27, in <module>
     from .defs import (
   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/defs.py", line
 24, in <module>
     from .bounding_box import calculate_bounding_box,
 is_non_empty_bounding_box
   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/bounding_box.py",
 line 26, in <module>
     from .features import match_features
   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/features.py",
 line 25, in <module>
     LOCALE = locale.getdefaultlocale()[0] or ''
   File
 "/Users/cabo/.homebrew/Cellar/python/3.7.2_1/Frameworks/Python.framework/Versions/3.7/lib/python3.7/locale.py",
 line 568, in getdefaultlocale
     return _parse_localename(localename)
   File
 "/Users/cabo/.homebrew/Cellar/python/3.7.2_1/Frameworks/Python.framework/Versions/3.7/lib/python3.7/locale.py",
 line 495, in _parse_localename
     raise ValueError('unknown locale: %s' % localename)
 ValueError: unknown locale: UTF-8

 *** xml2rfc failed, status 1 (possibly try with -r)
 }}}

-- 
---------------------------+----------------------------------
 Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
     Type:  defect         |     Status:  new
 Priority:  blocker        |  Milestone:
Component:  Version 2 cli  |    Version:  2.10.x
 Keywords:                 |
---------------------------+----------------------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/392>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Tue Feb  5 06:53:29 2019
Return-Path: <chopps@chopps.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 0DA4C12DF71 for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 06:53:28 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_NONE=-0.0001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id JEXhSdQZq4bu for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 06:53:26 -0800 (PST)
Received: from smtp.chopps.org (smtp.chopps.org [54.88.81.56]) by ietfa.amsl.com (Postfix) with ESMTP id 8794B12D4EF for <xml2rfc@ietf.org>; Tue,  5 Feb 2019 06:53:26 -0800 (PST)
Received: from tops.chopps.org (47-50-69-38.static.klmz.mi.charter.com [47.50.69.38]) (using TLSv1.2 with cipher AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by smtp.chopps.org (Postfix) with ESMTPS id CDA1960469; Tue,  5 Feb 2019 09:53:25 -0500 (EST)
User-agent: mu4e 1.1.0; emacs 26.1
From: Christian Hopps <chopps@chopps.org>
To: xml2rfc@ietf.org
Cc: chopps@chopps.org
Date: Tue, 05 Feb 2019 09:53:24 -0500
Message-ID: <sa6lg2uqobf.fsf@chopps.org>
MIME-Version: 1.0
Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature"
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/h138ieurYTtvkboI6SOVj3tWHKg>
Subject: [xml2rfc] <dl>, <dt> and <dd>
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 05 Feb 2019 14:53:28 -0000

--=-=-=
Content-Type: text/plain; format=flowed

I'm having a heck of a time getting a <dl> (definition list) working.

I see in the xml2rfc code that it talks about <dl> and hanging lists being deprecated etc, but I cannot get xml2rfc to actual produce any output when I use them. I have to disable DTD validation to even get it to parse.

Can someone help me with a short example of using a <dl> that xml2rfc will understand?

Thanks,
Chris.

--=-=-=
Content-Type: application/pgp-signature; name="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCgAdFiEEm56yH/NF+m1FHa6lLh2DDte4MCUFAlxZo2QACgkQLh2DDte4
MCX2pg/+OHka/fGBQ29QhoAl5kxWdo7mBiq2fo47wjuMgAEWVqyrau5/xWhvXtZu
XjJWT5BloaOQ6cmQdMQQBRjM2Wa1Iw5GGFl/pbGGukCL0i1v2c7Viv8G+59eCYtU
fkMPWGAiEAG5nMhYzBVzuta2IjX/3tN+BnNwt4W4RyJrizAKAftk+4rA7PXDgYWJ
mzPLLy3Pq9KMiatuQicgNqgfmYLGSxAPjUpy7k4zv+8k27iFaoqlmJixIdaPMK5t
1ciBIk7Soyz/YZfIlf5QrZ/ZFwlvzpBT5R7phj6knpWDCvNjSUu4mnAOj/bniga+
B2TUjE2mSCSht5w608DjqDKjwh9/D3Cx0J/ir2wpNWA9fTYD5MyBKC2Qn4QywFWa
cOzrwVAr7MBBDnyZbb4ENJxUrLbPdQAe5v1sNrpKp+vAa+zbQw0m/RiWFgQrP3Je
ST8yD0lBc2E/3S0ikuVGrKYnLPzyhu7fbUfYXNYFuIe2xz2mEjWK3coNCZNNXA+f
H4g4PUWjOcDsoMqagylf1Io84sZWLD+lwHpWRHhqXIQBSuYMEAOG9358jwiL6FAg
3SDo2GuByFir26KDjq09NliZFNDE3zfLRn2dAKeJsxYnhQKMb5eu2Ru9LzKAd8zB
fpWKMmdW34xK7tEuLyMyHvyRSRmRNhfDtS1zqGxEBZLJ12yKmpc=
=ragG
-----END PGP SIGNATURE-----
--=-=-=--


From nobody Tue Feb  5 08:04:20 2019
Return-Path: <randy@psg.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id A1FB3130E5E for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 08:04:18 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -5.501
X-Spam-Level: 
X-Spam-Status: No, score=-5.501 tagged_above=-999 required=5 tests=[BAYES_05=-0.5, RCVD_IN_DNSWL_HI=-5, SPF_PASS=-0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 6Kg7LHCBPNMx for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 08:04:17 -0800 (PST)
Received: from ran.psg.com (ran.psg.com [IPv6:2001:418:8006::18]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id F2AB1130E85 for <xml2rfc@ietf.org>; Tue,  5 Feb 2019 08:03:54 -0800 (PST)
Received: from localhost ([127.0.0.1] helo=ryuu.rg.net) by ran.psg.com with esmtp (Exim 4.90_1) (envelope-from <randy@psg.com>) id 1gr3CS-0001Vx-Hm; Tue, 05 Feb 2019 16:03:52 +0000
Date: Tue, 05 Feb 2019 08:03:52 -0800
Message-ID: <m2womez0gn.wl-randy@psg.com>
From: Randy Bush <randy@psg.com>
To: Christian Hopps <chopps@chopps.org>
Cc: xml2rfc@ietf.org
In-Reply-To: <sa6lg2uqobf.fsf@chopps.org>
References: <sa6lg2uqobf.fsf@chopps.org>
User-Agent: Wanderlust/2.15.9 (Almost Unreal) Emacs/25.3 Mule/6.0 (HANACHIRUSATO)
MIME-Version: 1.0 (generated by SEMI-EPG 1.14.7 - "Harue")
Content-Type: text/plain; charset=US-ASCII
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/DnueiGfttHFFEQ64xdqjLj2UbX8>
Subject: Re: [xml2rfc] <dl>, <dt> and <dd>
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 05 Feb 2019 16:04:19 -0000

> I'm having a heck of a time getting a <dl> (definition list) working.

i failed, so use hangText

> I see in the xml2rfc code that it talks about <dl> and hanging lists
> being deprecated etc

that will be painful

randy


From nobody Tue Feb  5 08:26:44 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 7AD41130E58 for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 08:26:43 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id Kfus25llhU6p for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 08:26:42 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 092B3130DE4 for <xml2rfc@ietf.org>; Tue,  5 Feb 2019 08:26:42 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:54935 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gr3YV-00042H-Lm; Tue, 05 Feb 2019 08:26:41 -0800
To: Christian Hopps <chopps@chopps.org>, xml2rfc@ietf.org
References: <sa6lg2uqobf.fsf@chopps.org>
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <9d1c955f-9d0f-df99-b2bc-9dccacc7875c@levkowetz.com>
Date: Tue, 5 Feb 2019 17:26:31 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <sa6lg2uqobf.fsf@chopps.org>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="nopnslTv1dkVO4nXVEmwTenSkq5ixDrfM"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, chopps@chopps.org
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/ONVCktkWfYChnYt5bXtD1ZXxb48>
Subject: Re: [xml2rfc] <dl>, <dt> and <dd>
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 05 Feb 2019 16:26:43 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--nopnslTv1dkVO4nXVEmwTenSkq5ixDrfM
Content-Type: multipart/mixed; boundary="H6sCXKkaaJXAheOtSj9b3k7R2C81aJcsj";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Christian Hopps <chopps@chopps.org>, xml2rfc@ietf.org
Message-ID: <9d1c955f-9d0f-df99-b2bc-9dccacc7875c@levkowetz.com>
Subject: Re: [xml2rfc] <dl>, <dt> and <dd>
References: <sa6lg2uqobf.fsf@chopps.org>
In-Reply-To: <sa6lg2uqobf.fsf@chopps.org>

--H6sCXKkaaJXAheOtSj9b3k7R2C81aJcsj
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable

Hi Christian,

On 2019-02-05 15:53, Christian Hopps wrote:
> I'm having a heck of a time getting a <dl> (definition list)
> working.
>=20
> I see in the xml2rfc code that it talks about <dl> and hanging lists
> being deprecated etc, but I cannot get xml2rfc to actual produce any
> output when I use them. I have to disable DTD validation to even get
> it to parse.
>=20
> Can someone help me with a short example of using a <dl> that xml2rfc
> will understand?

I think the issue here is that the legacy parser and formatters don't
understand the new vocabulary introduced with RFC 7991.  If you wish
to use that, you should give xml2rfc the --v3 switch, in order to tell
it to run in v3 mode.

Alternatively, you can indicate that your xml source file uses the
v3 vocabulary by setting the attribute version=3D"3" on the <rfc> element=
=2E

When v3 mode is deemed mature, it will become the default, and the xml2rf=
c
version will shift from 2.*.* to 3.*.*.


I hope that helps.

Regards,

	Henrik


--H6sCXKkaaJXAheOtSj9b3k7R2C81aJcsj--

--nopnslTv1dkVO4nXVEmwTenSkq5ixDrfM
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxZuTcACgkQTptXS4+7
FxpOTg//eJYYJhqRN5Omt8Dp2jlXgMqqPM+tRgw7LkMUCgHHIO0GKWFvmF/ux52z
SuW0bfMSGZPe+hrmgHRXMXrkdNWjZo19XwEd3W0S5jU7F3oTcmd6zfIAvAv7fyGB
HpWETis6KJFBa+qWOZVm2mEWJ1h6ogPPuIno6tVidkeZPyl/3kl7+3aBq58H8V88
xoFoarXrOBp+KiZVaDJdIzY1LSRK8IicpyG6vCqQm81I4WRUYDX9WZ0S+7EC20PL
AY3QAX2iGgJzD0ZLcB9cly4uxd3jnOwLP8moqmqW7y4FZC39t5lQuNmH4TFYGTW0
NEAAhEPrsJ/5/BG2J3LBldJdJLw59RPD5yEhGE3yS4vcJTneJnx8kYHML3TPdTjG
C4sa3+/pBQTZOykCEFGXhwJ7tWYF/eNOCfyj75U1yAEqJEFC6znd0KZAwispDbiE
YiAl+jLDd4KOzfT065Pfd6gkrL7C+9x64llTb3Au6UhrHWysZ2XBcGS5IRNE9pTW
XtlLRhIsObFrkR9e6fkszE2ScsRIcnBYfIHNVioACAnoHL4pnDu7x+8xY+kdnM6Q
ZNtIy1hMjrIT+FKKC/ciw8AeYeqKkEvjybN3EYl08b9h5pClG2B12YtrfN0UdN90
DC/QDVf92qhMr6KPbDCBobI+wJBdVU81osgW3Os7EniQWQ1CSAc=
=PI3t
-----END PGP SIGNATURE-----

--nopnslTv1dkVO4nXVEmwTenSkq5ixDrfM--


From nobody Tue Feb  5 10:14:02 2019
Return-Path: <watson@cloudflare.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id CD2DC130EB0 for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 10:14:00 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -6.553
X-Spam-Level: 
X-Spam-Status: No, score=-6.553 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIMWL_WL_HIGH=-4.553, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, RCVD_IN_DNSWL_NONE=-0.0001, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (1024-bit key) header.d=cloudflare.com
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id Mxb2HihP2lj8 for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 10:13:57 -0800 (PST)
Received: from mail-qk1-x741.google.com (mail-qk1-x741.google.com [IPv6:2607:f8b0:4864:20::741]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 8D0E6130EA0 for <xml2rfc@ietf.org>; Tue,  5 Feb 2019 10:13:56 -0800 (PST)
Received: by mail-qk1-x741.google.com with SMTP id z18so2644007qkj.10 for <xml2rfc@ietf.org>; Tue, 05 Feb 2019 10:13:56 -0800 (PST)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=cloudflare.com; s=google; h=mime-version:from:date:message-id:subject:to; bh=8X/oBymjsCrL0Y3FdWYnJf3iLBxXrNxGolGRoKVYDaA=; b=g6KV2E3CW6/KZDwPffx2pp8bMfo3PAvOZy/FnblzZAlfokbMrBZcR4AXHM08j+lvlO a6Lb4XN6rzswJkts1iJHERjcg78F2KJH9mibg/9iAaUMAeP3cWsiDYd9ECMYlaaYld0q ffr53KY8H8abARbjJxLsSCu0pP0LCMI+RcjJs=
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:from:date:message-id:subject:to; bh=8X/oBymjsCrL0Y3FdWYnJf3iLBxXrNxGolGRoKVYDaA=; b=QtbVCBJruEsm9FxUA/x0IPO8fmazHpW3iFakbZjR5PdxtRpopAbKCzXFvh0BUxBoUG mDXvIJ34cq/5TEGGXB6LyuSzfVZvMeudYpUrbot2NXrq/ILVFt3jBPvok55M0H7dRKsA 1qNZqzOJr4ssbFJcQ/JrVCipSa3fAdxlYiJdL/wrc/evzTC8CoyPhlB4cfiFXsh00RI+ G+Etk3FP8GZSJI+vyeA7yNQdxU1IbIYu8CCTL+h48N6nICdYEhRvZJGwERzBdPnejx6M zLZ9bhWYcTWjQ59A6YXeIbHc0gLQPaHMvodsrptRcK8KGOyNAS5LYXfUJILqErzPN85j rynA==
X-Gm-Message-State: AHQUAuaCqx3PdxvxIwpnEXXgXmqzHNfMlgrvWt9FxsmhwxdxOY8c0Vbi tWPs6pPZZqR/RssLho3XXlnplmLH492tYQ2rBNi9fsf7bwhLsA==
X-Google-Smtp-Source: AHgI3IYCuKDFQYHICIfLFngE/TIE1Iz7EZjuF7Lz5cJdcwDRoaA0/e3fJpf0Z2YCJ8j7Hi1LPg6TDsKlp9LoVEZvXuw=
X-Received: by 2002:a37:4145:: with SMTP id o66mr4382341qka.129.1549390435050;  Tue, 05 Feb 2019 10:13:55 -0800 (PST)
MIME-Version: 1.0
From: Watson Ladd <watson@cloudflare.com>
Date: Tue, 5 Feb 2019 10:13:43 -0800
Message-ID: <CAN2QdAHVNyYA4UP3-1UBbbaJwsu3+FP5Ro3BLm4OYqY=nYQrpw@mail.gmail.com>
To: xml2rfc@ietf.org
Content-Type: multipart/mixed; boundary="00000000000080482905812992db"
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/g6-f6mP4qQEgbLd3CTEwe3t8oQA>
Subject: [xml2rfc] Trying to cite RFC 20 produces errors
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 05 Feb 2019 18:14:01 -0000

--00000000000080482905812992db
Content-Type: text/plain; charset="UTF-8"

Dear XML2RFC people,

I am trying to cite RFC 20. Despite the URL in the entity definition
in the head, http:///xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml,
pointing me to the right thing,
the xml2rfc tool produces an error:

Parsing file INPUT
Resolving entity...
/usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629.dtd
Resolving entity...
/usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629-xhtml.ent
Resolving entity...
/usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629-other.ent
Resolving entity...
/usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629.dtd
Resolving entity...
/usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629-xhtml.ent
Resolving entity...
/usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629-other.ent
Resolving entity...
http://xml.resource.org/public/rfc/bibxml/reference.RFC.5280.xml
Loaded from cache reference.RFC.5280.xml
Resolving entity...
http://xml.resource.org/public/rfc/bibxml/reference.RFC.5905.xml
Loaded from cache reference.RFC.5905.xml
Resolving entity...
http://xml.resource.org/public/rfc/bibxml/reference.RFC.7384.xml
Loaded from cache reference.RFC.7384.xml
Resolving entity...
http://xml.resource.org/public/rfc/bibxml/reference.RFC.8174.xml
Loaded from cache reference.RFC.8174.xml
Resolving entity...
http://xml.resource.org/public/rfc/bibxml/reference.RFC.2119.xml
Loaded from cache reference.RFC.2119.xml
Resolving entity...
https://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
 ... 400 https://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
URL retrieval failed with status code 400 for
'https://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml'
Resolving entity...
https://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
 ... 400 https://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
URL retrieval failed with status code 400 for
'https://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml'
Resolving entity...
http://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
 ... 400 http://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
URL retrieval failed with status code 400 for
'http://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml'
Resolving entity...
http://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
 ... 400 http://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
URL retrieval failed with status code 400 for
'http://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml'
Error: Unable to resolve external request:
"../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml",
trying the following location(s):
    /home/www/tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
    /home/www/tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml2/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
    /home/www/tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml3/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
    /home/www/tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml4/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
    /home/www/tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml5/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
    /home/www/tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml6/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
    /home/www/tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml7/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
    /home/www/tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml8/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
    https://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
    https://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
    http://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
    http://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
Error: Unable to parse the XML document: INPUT
 <string>: Line 238: Failure to process entity RFC0020
 <string>: Line 238: Entity 'RFC0020' not defined

Please let me know what I'm doing wrong. I'm happy to minimize the
input on request.

Sincerely,
Watson Ladd

--00000000000080482905812992db
Content-Type: text/xml; charset="US-ASCII"; name="draft-roughtime-aanchal.xml"
Content-Disposition: attachment; filename="draft-roughtime-aanchal.xml"
Content-Transfer-Encoding: base64
Content-ID: <f_jrs31mld0>
X-Attachment-Id: f_jrs31mld0

PD94bWwgdmVyc2lvbj0iMS4wIiBlbmNvZGluZz0iVVMtQVNDSUkiPz4gPCFET0NUWVBFIHJmYyBT
WVNURU0gInJmYzI2MjkuZHRkIiBbCjwhRU5USVRZIFJGQzIxMTkgU1lTVEVNCiJodHRwOi8veG1s
LnJlc291cmNlLm9yZy9wdWJsaWMvcmZjL2JpYnhtbC9yZWZlcmVuY2UuUkZDLjIxMTkueG1sIj4g
PCFFTlRJVFkKUkZDNTI4MCBTWVNURU0KImh0dHA6Ly94bWwucmVzb3VyY2Uub3JnL3B1YmxpYy9y
ZmMvYmlieG1sL3JlZmVyZW5jZS5SRkMuNTI4MC54bWwiPiA8IUVOVElUWQpSRkM1OTA1IFNZU1RF
TQoiaHR0cDovL3htbC5yZXNvdXJjZS5vcmcvcHVibGljL3JmYy9iaWJ4bWwvcmVmZXJlbmNlLlJG
Qy41OTA1LnhtbCI+IDwhRU5USVRZClJGQzgxNzQgU1lTVEVNCiJodHRwOi8veG1sLnJlc291cmNl
Lm9yZy9wdWJsaWMvcmZjL2JpYnhtbC9yZWZlcmVuY2UuUkZDLjgxNzQueG1sIj4gPCFFTlRJVFkK
UkZDNzM4NCBTWVNURU0KImh0dHA6Ly94bWwucmVzb3VyY2Uub3JnL3B1YmxpYy9yZmMvYmlieG1s
L3JlZmVyZW5jZS5SRkMuNzM4NC54bWwiPgo8IUVOVElUWSBSRkMwMDIwIFNZU1RFTQoiaHR0cDov
Ly94bWwycmZjLmlldGYub3JnL3B1YmxpYy9yZmMvYmlieG1sL3JlZmVyZW5jZS5SRkMuMDAyMC54
bWwiPgpdPgoKPD94bWwtc3R5bGVzaGVldCB0eXBlPSd0ZXh0L3hzbCcgaHJlZj0ncmZjMjYyOS54
c2x0JyA/Pgo8P3JmYyBzdHJpY3Q9InllcyI/Pgo8P3JmYyB0b2M9Im5vIj8+Cjw/cmZjIHRvY2Rl
cHRoPSIzIj8+Cjw/cmZjIHN5bXJlZnM9InllcyI/Pgo8P3JmYyBzb3J0cmVmcz0ieWVzIj8+Cjw/
cmZjIGNvbXBhY3Q9InllcyI/Pgo8P3JmYyBzdWJjb21wYWN0PSJubyI/PgoKPHJmYyBjYXRlZ29y
eT0iaW5mbyIgZG9jTmFtZT0iZHJhZnQtcm91Z2h0aW1lLWFhbmNoYWwtMDAiIGlwcj0idHJ1c3Qy
MDA5MDIiPgogIDxmcm9udD4KICAgIDx0aXRsZT5Sb3VnaHRpbWU8L3RpdGxlPgoKICAgIDxhdXRo
b3IgZnVsbG5hbWU9IkFhbmNoYWwgTWFsaG90cmEiIGluaXRpYWxzPSJBLiIgc3VybmFtZT0iTWFs
aG90cmEiPgogICAgICAgIDxvcmdhbml6YXRpb24+Qm9zdG9uIFVuaXZlcnNpdHk8L29yZ2FuaXph
dGlvbj4KICAgICAgICA8YWRkcmVzcz4KICAgICAgICAgICAgPHBvc3RhbD4KICAgICAgICAgICAg
ICAgIDxzdHJlZXQ+MTExIEN1bW1pbmd0b24gTWFsbDwvc3RyZWV0PgogICAgICAgICAgICAgICAg
PGNpdHk+Qm9zdG9uPC9jaXR5PgogICAgICAgICAgICAgICAgPHJlZ2lvbj48L3JlZ2lvbj4KICAg
ICAgICAgICAgICAgIDxjb2RlPjAyMjE1PC9jb2RlPgogICAgICAgICAgICAgICAgPGNvdW50cnk+
VVNBPC9jb3VudHJ5PgogICAgICAgICAgICA8L3Bvc3RhbD4KICAgICAgICAgICAgPGVtYWlsPmFh
bmNoYWw0QGJ1LmVkdTwvZW1haWw+CiAgICAgICAgPC9hZGRyZXNzPgogICAgPC9hdXRob3I+Cgog
ICAgPGF1dGhvciBmdWxsbmFtZT0iQWRhbSBMYW5nbHkiIGluaXRpYWxzPSJBLiIgc3VybmFtZT0i
TGFuZ2x5Ij4KICAgICAgPG9yZ2FuaXphdGlvbj5Hb29nbGUgPC9vcmdhbml6YXRpb24+CiAgICA8
L2F1dGhvcj4KCiAgICA8YXV0aG9yIGZ1bGxuYW1lPSJXYXRzb24gTGFkZCIgaW5pdGlhbHM9Ilcu
IiBzdXJuYW1lPSJMYWRkIj4KICAgICAgICA8b3JnYW5pemF0aW9uPiBDbG91ZGZsYXJlPC9vcmdh
bml6YXRpb24+CiAgICAgICAgPGFkZHJlc3M+CiAgICAgICAgICAgIDxwb3N0YWw+CiAgICAgICAg
ICAgICAgICA8c3RyZWV0PjEwMSBUb3duc2VuZCBTdDwvc3RyZWV0PgogICAgICAgICAgICAgICAg
PGNpdHk+U2FuIEZyYW5jaXNjbzwvY2l0eT4KICAgICAgICAgICAgICAgIDxyZWdpb24+PC9yZWdp
b24+CiAgICAgICAgICAgICAgICA8Y291bnRyeT5VU0E8L2NvdW50cnk+CiAgICAgICAgICAgIDwv
cG9zdGFsPgogICAgICAgICAgICA8ZW1haWw+d2F0c29uQGNsb3VkZmxhcmUuY29tPC9lbWFpbD4K
ICAgICAgICA8L2FkZHJlc3M+CiAgICA8L2F1dGhvcj4KCiAgICA8ZGF0ZSB5ZWFyPSIyMDE5IiBt
b250aD0iRmVicnVhcnkiIGRheT0iMSIvPgoKICAgIDxhcmVhPkdlbmVyYWw8L2FyZWE+CgogICAg
PHdvcmtncm91cD5JbnRlcm5ldCBFbmdpbmVlcmluZyBUYXNrIEZvcmNlPC93b3JrZ3JvdXA+Cgog
ICAgPGtleXdvcmQ+cm91Z2h0aW1lPC9rZXl3b3JkPgoKICAgIDxrZXl3b3JkPnRpbWUgc3luY2hy
b25pemF0aW9uPC9rZXl3b3JkPgoKICAgIDxhYnN0cmFjdD4KICAgICAgPHQ+CiAgICAgICAgVGhp
cyBkb2N1bWVudCBzcGVjaWZpZXMgUm91Z2h0aW1lIC0gYSBwcm90b2NvbCB0aGF0IGFpbXMgdG8g
YWNoaWV2ZSByb3VnaCB0aW1lIHN5bmNocm9uaXphdGlvbiB3aGlsZSBkZXRlY3Rpbmcgc2VydmVy
cyB0aGF0IHByb3ZpZGUgaW5hY2N1cmF0ZSB0aW1lIGFuZCBwcm92aWRpbmcgY3J5cHRvZ3JhcGhp
YyBwcm9vZiBvZiB0aGVpciBtYWxmZWFzYW5jZS4KICAgICAgPC90PgogICAgPC9hYnN0cmFjdD4K
ICA8L2Zyb250PgoKICA8bWlkZGxlPgogICAgPHNlY3Rpb24gdGl0bGU9IkludHJvZHVjdGlvbiI+
CiAgICAgIDx0PgogICAgICBSb3VnaHRpbWUgaXMgYSBwcm90b2NvbCBmb3Igcm91Z2ggdGltZSBz
eW5jaHJvbml6YXRpb24gdGhhdCBlbmFibGVzIGNsaWVudHMgdG8gcHJvdmlkZSBjcnlwdG9ncmFw
aGljIHByb29mIG9mIHNlcnZlciBtYWxmZWFzYW5jZS4gSXQgZG9lcyBzbyBieSBoYXZpbmcgcmVz
cG9uc2VzIGZyb20gc2VydmVycyBpbmNsdWRlIGEgc2lnbmF0dXJlIHdpdGggYSBsb25nIHRlcm0g
cHVibGljIGtleSBvdmVyIGEgcG9ydGlvbiBvZiB0aGUgaW5pdGlhbCByZXF1ZXN0LCB0aHVzIHBy
b3ZpZGluZyBjcnlwdG9ncmFwaGljIHByb29mIHRoYXQgdGhlIHRpbWVzdGFtcCB3YXMgaXNzdWVk
IGFmdGVyIHByZXZpb3VzIHJlc3BvbnNlcyBhbmQgYmVmb3JlIGZ1dHVyZSBvbmVzLgogICAgICA8
L3Q+CiAgICAgIDx0PgogICAgICA8bGlzdCBzdHlsZSA9ICJidWxsZXQiPgogICAgICAgIDx0PiBO
VFAgPC90PgogICAgICAgIDx0PiBDaHJvbm9zIDwvdD4KICAgICAgICA8dD4gTUQ1IE5UUCA8L3Q+
CiAgICAgICAgPHQ+IEFOVFAgPC90PgogICAgICAgIDx0PiBOVFMgPC90PgogICAgICAgIDx0PiBS
b3VnaHRpbWUgPC90PgogICAgICA8L2xpc3Q+CiAgICA8L3Q+CiAgICAgIDx0ZXh0dGFibGUgYW5j
aG9yID0gImV4aXN0aW5nX2FwcHJvYWNoZXMiPgogICAgICAgIDxwcmVhbWJsZT4gVEJEIDwvcHJl
YW1ibGU+CiAgICAgICAgPHR0Y29sIGFsaWduPSdjZW50ZXInPlByb3RvY29sPC90dGNvbD4KICAg
PHR0Y29sIGFsaWduPSdjZW50ZXInPk5ldHdvcms8L3R0Y29sPgogICA8dHRjb2wgYWxpZ249J2Nl
bnRlcic+VW5jb25kaXRpb25hbCBTZXJ2ZXI8L3R0Y29sPgogICA8dHRjb2wgYWxpZ249J2NlbnRl
cic+VmVyaWZpZWQgU2VydmVyPC90dGNvbD4KICAgPHR0Y29sIGFsaWduPSdjZW50ZXInPlNlcnZl
ciBNYWxmZWFzYW5jZSBFdmlkZW5jZTwvdHRjb2w+CiAgIDxjPk5UUDwvYz4KICAgPGM+TlRQPC9j
PjxjPk5UUDwvYz48Yz5OVFA8L2M+PGM+TlRQPC9jPgogICA8Yz5DaHJvbm9zPC9jPjxjPkNocm9u
b3M8L2M+PGM+Q2hyb25vczwvYz48Yz5DaHJvbm9zPC9jPjxjPkNocm9ub3M8L2M+CiAgIDxjPk5U
UC1NRDU8L2M+PGM+TlRQLU1ENTwvYz48Yz5OVFAtTUQ1PC9jPjxjPk5UUC1NRDU8L2M+PGM+TlRQ
LU1ENTwvYz4KICAgPGM+QU5UUDwvYz48Yz5BTlRQPC9jPjxjPkFOVFA8L2M+PGM+QU5UUDwvYz48
Yz5BTlRQPC9jPgogICA8Yz5OVFM8L2M+PGM+TlRTPC9jPjxjPk5UUzwvYz48Yz5OVFM8L2M+PGM+
TlRTPC9jPgogICA8Yz5Sb3VnaHRpbWU8L2M+PGM+Um91Z2h0aW1lPC9jPjxjPlJvdWdodGltZTwv
Yz48Yz5Sb3VnaHRpbWU8L2M+PGM+Um91Z2h0aW1lPC9jPgogICAgICAgIDxwb3N0YW1ibGU+ICAg
VEJEIDwvcG9zdGFtYmxlPgogICAgICA8L3RleHR0YWJsZT4KICAgIDwvc2VjdGlvbj4KPHNlY3Rp
b24gdGl0bGUgPSAiUmVxdWlyZW1lbnRzIExhbmd1YWdlIj4KICA8dD4KICAgIFRoZSBrZXkgd29y
ZHMgIk1VU1QiLCAiTVVTVCBOT1QiLCAiUkVRVUlSRUQiLCAiU0hBTEwiLCAiU0hBTEwKICAgICAg
Tk9UIiwgIlNIT1VMRCIsICJTSE9VTEQgTk9UIiwgIlJFQ09NTUVOREVEIiwgIk5PVCBSRUNPTU1F
TkRFRCIsCiAgICAgICJNQVkiLCBhbmQgIk9QVElPTkFMIiBpbiB0aGlzIGRvY3VtZW50IGFyZSB0
byBiZSBpbnRlcnByZXRlZCBhcwogICAgICBkZXNjcmliZWQgaW4gQkNQIDE0IDx4cmVmIHRhcmdl
dD0iUkZDMjExOSI+PC94cmVmPiA8eHJlZiB0YXJnZXQ9IlJGQzgxNzQiPjwveHJlZj4gd2hlbiwg
YW5kIG9ubHkgd2hlbiwgdGhleSBhcHBlYXIgaW4gYWxsIGNhcGl0YWxzLCBhcyBzaG93biBoZXJl
LgogIDwvdD4KPC9zZWN0aW9uPgo8c2VjdGlvbiB0aXRsZSA9ICJUZXJtaW5vbG9neSI+CiAgPHQ+
CiAgICBUQkQKICA8L3Q+Cjwvc2VjdGlvbj4KPHNlY3Rpb24gdGl0bGUgPSAiUHJvdG9jb2wgT3Zl
cnZpZXciPgogIDx0PgogICAgU2luZ2xlIFNlcnZlciBNb2RlOiBBdCBpdHMgbW9zdCBiYXNpYyBs
ZXZlbCwgUm91Z2h0aW1lIGlzIGEgb25lIHJvdW5kIHByb3RvY29sIGluIHdoaWNoIGEgY29tbGV0
ZWx5IGZyZXNoIGNsaWVudCByZXF1ZXN0cyB0aGUgY3VycmVudCB0aW1lIGFuZCB0aGUgc2VydmVy
IHNlbmRzIGEgc2lnbmVkIHJlc3BvbnNlLiBUaGUgcmVzcG9uc2UgaXMgY29tcHJpc2VkIG9mIGEg
dGltZXN0YW1wICh0aGUgbnVtYmVyIG9mIG1pY3Jvc2Vjb25kcyBzaW5jZSB0aGUgVW5peCBlcG9j
aCkgYW5kIGEgcmFkaXVzIChpbiBtaWNyb3NlY29uZHMpIHVzZWQgdG8gaW5kaWNhdGUgdGhlIHNl
cnZlcnMgY2VydGFpbnR5IGFib3V0IHRoZSByZXBvcnRlZCB0aW1lLiBGb3IgZXhhbXBsZSwgYSBy
YWRpdXMgb2YgMSwwMDAsMDAwIG1pY3Jvc2VjIG1lYW5zIHRoZSBzZXJ2ZXIgaXMgYWJzb2x1dGVs
eSBjb25maWRlbnQgdGhhdCB0aGUgdHJ1ZSB0aW1lIGlzIHdpdGhpbiBvbmUgc2Vjb25kIG9mIHRo
ZSByZXBvcnRlZCB0aW1lLgogIDwvdD4KICA8dD4KICAgIFRoZSBzZXJ2ZXIgcHJvdmVzIGZyZXNo
bmVzcyBvZiBpdHMgcmVzcG9uc2UgYXMgZm9sbG93cy4gVGhlIHJlcXVlc3QgY29udGFpbnMgYSBy
YW5kb20gY2hhbGxlbmdlLiBUaGUgc2VydmVyIGluY29ycG9yYXRlcyB0aGUgY2hhbGxlbmdlIGlu
dG8gaXRzIHNpZ25lZCByZXNwb25zZSBzbyB0aGF0IGl0cyBuZWVkZWQgdG8gdmVyaWZ5IHRoZSBz
aWduYXR1cmUuIFRoaXMgcHJvdmVzIHRoYXQgdGhlIHNpZ25lZCByZXNwb25zZSBjb3VsZCBvbmx5
IGhhdmUgYmVlbiBnZW5lcmF0ZWQgYWZ0ZXIgdGhlIGNoYWxsZW5nZSB3YXMgaXNzdWVkIGlmIHRo
ZSBjaGFsbGVuZ2UgaGFzIHN1ZmZpY2VudCBlbnRyb3B5LgogIDwvdD4KICA8dD4KICAgIFRoZSBj
bGllbnQgdXNlcyB0aGUgc2VydmVycyByb290IHB1YmxpYyBrZXkgdG8gdmVyaWZ5IHRoZSBzaWdu
YXR1cmUuIChUaGUga2V5IGlzIG9idGFpbmVkIG91dC1vZi1iYW5kLikgV2hlbiB0aGUgc2VydmVy
IHN0YXJ0cywgaXQgZ2VuZXJhdGVzIGFuIG9ubGluZSBwdWJsaWMvc2VjcmV0IGtleSBwYWlyLCB0
aGUgcm9vdCBzZWNyZXQga2V5IGlzIHVzZWQgdG8gY3JlYXRlIGEgZGVsZWdhdGlvbiBmb3IgdGhl
IG9ubGluZSBwdWJsaWMga2V5LCBhbmQgdGhlIG9ubGluZSBzZWNyZXQga2V5IGlzIHVzZWQgdG8g
c2lnbiB0aGUgcmVzcG9uc2UuIFRoZSBkZWxlZ2F0aW9uIHNlcnZlcyB0aGUgc2FtZSBmdW5jdGlv
biBhcyBhIHRyYWRpdGlvbmFsIFguNTA5IGNlcnRpZmljYXRlIG9uIHRoZSB3ZWIgYXMgaWxsdXN0
cmF0ZWQgaW4gdGhlIGZpZ3VyZSBiZWxvdywgdGhlIGNsaWVudCBmaXJzdCB1c2VzIHRoZSByb290
IHB1YmxpYyBrZXkgdG8gdmVyaWZ5IHRoZSBkZWxlZ2F0aW9uLCB0aGVuIHVzZXMgdGhlIG9ubGlu
ZSBwdWJsaWMga2V5IHRvIHZlcmlmeSB0aGUgcmVzcG9uc2UuIFRoaXMgYWxsb3dzIGZvciBvcGVy
YXRpb25hbCBzZXBhcmF0aW9uIG9mIHRoZSBkZWxlZ2F0b3IgYW5kIHRoZSBzZXJ2ZXIgYW5kIGxp
bWl0cyBleHBvc3VyZSBvZiB0aGUgcm9vdCBzZWNyZXQga2V5LgogICAgSXQga25vd3MgdGhhdCBp
dHMgYXV0aGVudGljIGJlY2F1c2UgaXQgaGFzIGEgc2lnbmF0dXJlIGZyb20gdGhlIHNlcnZlci4g
QnV0IGlmIGl0IGRvZXNudCBjb21wbGV0ZWx5IHRydXN0IHRoZSBzZXJ2ZXIgaXQgY2FuIGFzayBh
bm90aGVyIHNlcnZlciBmb3IgdGhlIHRpbWUuCiAgPC90PgogIDx0PgogICAgQ2hhaW5pbmcgbXVs
dGlwbGUgc2VydmVycyBGb3IgdGhlIHNlY29uZCByZXF1ZXN0LCB0aGUgY2xpZW50IGdlbmVyYXRl
cyBpdHMgbm9uY2UgYnkgaGFzaGluZyB0aGUgcmVwbHkgZnJvbSB0aGUgZmlyc3Qgc2VydmVyIHdp
dGggYSByYW5kb20gdmFsdWUuIFRoaXMgcHJvdmVzIHRoYXQgdGhlIG5vbmNlIHdhcyBjcmVhdGVk
IGFmdGVyIHRoZSByZXBseSBmcm9tIHRoZSBmaXJzdCBzZXJ2ZXIuIEl0IHNlbmRzIHRoYXQgdG8g
dGhlIHNlY29uZCBzZXJ2ZXIgYW5kIHJlY2VpdmVzIGEgc2lnbmF0dXJlIGZyb20gaXQgY292ZXJp
bmcgdGhhdCBub25jZSBhbmQgdGhlIHRpbWUgZnJvbSB0aGUgc2Vjb25kIHNlcnZlci4gTGV0IHVz
IGFzc3VtZSB0aGF0IHRoZSB0aW1lcyBmcm9tIHRoZSB0d28gc2VydmVycyBhcmUgc2lnbmlmaWNh
bnRseSBkaWZmZXJlbnQuIAogIDwvdD4KICA8dD4KICAgIENyeXB0b2dyYXBoaWMgUHJvb2Ygb2Yg
bWlzYmVoYXZpb3IgSWYgdGhlIHRpbWUgZnJvbSB0aGUgc2VydmVyIHNlY29uZCBzZXJ2ZXIgaXMg
YmVmb3JlIHRoZSBmaXJzdCwgdGhlbiB0aGUgY2xpZW50IGhhcyBwcm9vZiBvZiBtaXNiZWhhdmlv
dXI6IHRoZSByZXBseSBmcm9tIHRoZSBzZWNvbmQgc2VydmVyIGltcGxpY2l0bHkgc2hvd3MgdGhh
dCBpdCB3YXMgY3JlYXRlZCBsYXRlciBiZWNhdXNlIG9mIHRoZSB3YXkgdGhhdCB0aGUgY2xpZW50
IGNvbnN0cnVjdGVkIHRoZSBub25jZS4gSWYgdGhlIHRpbWUgZnJvbSB0aGUgc2Vjb25kIHNlcnZl
ciBpcyBhZnRlciwgdGhlbiB0aGUgY2xpZW50IGNhbiBjb250YWN0IHRoZSBmaXJzdCBzZXJ2ZXIg
YWdhaW4gYW5kIGdldCBhIHNpZ25hdHVyZSB0aGF0IHdhcyBwcm92YWJseSBjcmVhdGVkIGFmdGVy
d2FyZHMsIGJ1dCB3aXRoIGFuIGVhcmxpZXIgdGltZXN0YW1wLgogIDwvdD4KICA8dD4KICAgIFdp
dGggb25seSB0d28gc2VydmVycywgdGhlIGNsaWVudCBjYW4gZW5kIHVwIHdpdGggcHJvb2YgdGhh
dCBzb21ldGhpbmcgaXMgd3JvbmcsIGJ1dCBubyBpZGVhIHdoYXQgdGhlIGNvcnJlY3QgdGltZSBp
cy4gQnV0IHdpdGggaGFsZiBhIGRvemVuIG9yIG1vcmUgaW5kZXBlbmRlbnQgc2VydmVycywgdGhl
IGNsaWVudCB3aWxsIGVuZCB1cCB3aXRoIGNoYWluIG9mIHByb29mIG9mIGFueSBzZXJ2ZXJzIG1p
c2JlaGF2aW91ciwgc2lnbmVkIGJ5IHNldmVyYWwgb3RoZXJzLCBhbmQgKHByZXN1bWFibHkpIGVu
b3VnaCBhY2N1cmF0ZSByZXBsaWVzIHRvIGVzdGFibGlzaCB3aGF0IHRoZSBjb3JyZWN0IHRpbWUg
aXMuCiAgPC90Pgo8L3NlY3Rpb24+CjxzZWN0aW9uIHRpdGxlID0gIk1lc3NhZ2UgRm9ybWF0Ij4K
ICA8dD4KICBBIFJvdWdodGltZSBwYWNrZXQgaXMgYSBVRFAgcGFja2V0IGNvbnRhaW5pbmcgYSBt
YXAgZnJvbSB1aW50MzJzIHRvIHN0cmluZ3Mgb2YgYnl0ZXMuIFRoZSBieXRlIHN0cmluZ3MgbXVz
dCBhbGwKICBoYXZlIGxlbmd0aHMgYSBtdWx0aXBsZSBvZiBmb3VyLiBBbGwgdWludDMyIGFyZSBl
bmNvZGVkIHdpdGggdGhlIGxlYXN0IHNpZ25pZmljYW50IGJ5dGUgZmlyc3QuIFRoZSBrZXlzIG9m
IHRoaXMgbWFwIGFyZSBjYWxsZWQgdGFncy4KICA8L3Q+CiAgPHQ+CiAgQSBSb3VnaHRpbWUgcGFj
a2V0IGlzIHNlcmlhbGl6ZWQgYXMgZm9sbG93czogRmlyc3QgdGhlcmUgaXMgYSBoZWFkZXIuCiAg
VGhlIGZpcnN0IGZvdXIgYnl0ZXMgaW4gdGhlIGhlYWRlciBhcmUgdGhlIHVpbnQzMiBudW1iZXIg
b2YgdGFncyBOLCBhbmQgaGVuY2Ugb2YgKHRhZywgdmFsdWUpIHBhaXJzLgogIDQqKE4tMSkgYnl0
ZXMgYXJlIG9mZnNldHMsIGVhY2ggb2Zmc2V0IGEgdWludDMyLgogIFRoZSBsYXN0IDQqTiBieXRl
cyBhcmUgdGhlIHRhZ3MuCiAgPC90PgogIDx0PgoKICBUYWdzIGFyZSBpbiBhc2NlbmRpbmcgb3Jk
ZXIsIGFuZCBubyB0YWcgY2FuIGJlIHJlcGVhdGVkLiBPZmZzZXRzIGFyZSBhbGwgYSBtdWx0aXBs
ZSBvZiBmb3VyIGFuZCBNVVNUIGJlIHN0cmljdGx5IGluY3JlYXNpbmcuIFRoZSBvZmZzZXQgYXJy
YXkgaXMgY29uc2lkZXJlZAogIHRvIGhhdmUgYSBub3QgZXhwbGljdGx5IGVuY29kZWQgdmFsdWUg
b2YgbGVuZ3RoIDAuCiAgPC90PgogIDx0PgogIEltbWVkaWF0ZWx5IGZvbGxvd2luZyB0aGUgaGVh
ZGVyIGlzIGEgY29uY2F0ZW5hdGlvbiBvZiBhbGwgdGhlIGJ5dGVzLiBUaGUgZmlyc3QgcG9zdC1o
ZWFkZXIgYnl0ZSBpcyBhdCBvZmZzZXQgMCwgYW5kIHRoZSBlbmQgb2YgdGhlIGZpbmFsIGJ5dGUg
c3RyaW5nIGlzCiAgaW5kaWNhdGVkIGJ5IHRoZSBlbmQgb2YgdGhlIHBhY2tldC4gVGhlIGl0aCBi
eXRlIHN0cmluZyAgZW5kcyBhdCBvZmZzZXRbaSsxXS0xLgogIDwvdD4KICA8dD4KICBUaGlzIGVu
Y29kaW5nIG1heSBiZSByZWN1cnNpdmU6IGEgdmFsdWUgbWF5IGJlIHNhaWQgdG8gYmUgaW4gUm91
Z2h0aW1lIHBhY2tldCBmb3JtYXQgYW5kIHRodXMgaGF2ZSBhIGhlYWRlciwgZXRjLgogIFRhZ3Mg
bWF5IGJlIGxpc3RlZCBhcyBmb3VyIEFTQ0lJIGNoYXJhY3RlcnMuIDx4cmVmIHRhcmdldD0iUkZD
MDAyMCIvPiBJbiB0aGlzIGNhc2UgdGhlIHRhZyB3aGVuIHNlcmlhbGl6ZWQgd2lsbCBiZSB0aG9z
ZSBmb3VyIEFTQ0lJIGNoYXJhY3RlcnMuIEV4ZW1wbGEgZ3JhdGlhIE5PTkMgd291bGQgYmUgdGhl
IG51bWVyaWMgdmFsdWUgMHg0MzRlNGY0ZS4KICBUaGV5IG1heSBhbHNvIGJlIGxpc3RlZCBhcyBm
ZXdlciB0aGVuIGZvdXIgQVNDSUkgY2hhcmFjdGVycyB3aXRoIGhleCBlc2NhcGUgY29kZXMgYXQg
dGhlIGVuZC4KICA8L3Q+Cjwvc2VjdGlvbj4KCjxzZWN0aW9uIHRpdGxlPSJRdWVyaWVzIj4KICA8
dD4KICBBIHF1ZXJ5IGlzIGEgUm91Z2h0aW1lIHBhY2tldCB3aXRoIHRoZSB0YWcgIE5PTkMuIFRo
ZSBjb250ZW50cyBvZiBOT05DIGFyZSA2NCBieXRlcy4gVGhlIHJlcXVlc3QgcGFja2V0IE1VU1Qg
YmUgYSBtaW5pbXVtIG9mIDEwMjQgYnl0ZXMuIFRvIGF0dGFpbiB0aGlzIHNpemUgdGhlIHRhZyBQ
QURceGZmIE1BWSBiZSBhZGRlZCBhdCB0aGUgZW5kIG9mIHRoZSBwYWNrZXQuIE90aGVyCiAgdGFn
cyBNVVNUIGJlIGlnbm9yZWQgYnkgdGhlIHNlcnZlci4gRnV0dXJlIHZlcnNpb25zIG1heSBzcGVj
aWZ5IHRhZ3MgYW5kIHRoZWlyIHNlbWFudGljcy4KICA8L3Q+Cjwvc2VjdGlvbj4KPHNlY3Rpb24g
dGl0bGU9IlJlc3BvbnNlcyI+CiAgPHQ+CiAgQSByZXNwb25zZSBjb250YWlucyB0aGUgZm9sbG93
aW5nIHRhZ3M6CiAgPGxpc3Q+CiAgICA8dD5TUkVQPC90PgogICAgPHQ+U0lHXHgwMDwvdD4KICAg
IDx0PkNFUlQ8L3Q+CiAgICA8dD5JTkRYPC90PgogICAgPHQ+UEFUSDwvdD4KICA8L2xpc3Q+Cgog
IFNSRVAgdmFsdWUgY29udGFpbnMgdGhlIGZvbG93aW5nIHRhZ3M6CiAgPGxpc3Q+CiAgICA8dD5S
T09UPC90PgogICAgPHQ+CiAgICA8L3Q+CiAgPC9saXN0PgogIDwvdD4KPC9zZWN0aW9uPgo8c2Vj
dGlvbiB0aXRsZT0iVGhlIHNtZWFyZWQgc2NhbGUiPgo8dD4KICBFdmVyeSBkYXkgaW4gUm91Z2h0
aW1lIGhhcyA4NDYwMCBzZWNvbmRzLgo8L3Q+Cjwvc2VjdGlvbj4KCgo8c2VjdGlvbiB0aXRsZT0i
Q2xvdWRmbGFyZSdzIFJvdWdodGltZSBTZXJ2aWNlIEltcGxlbWVudGF0aW9uIj4KICA8dD4KICAg
IAogIDwvdD4KPC9zZWN0aW9uPgoKCjxzZWN0aW9uIGFuY2hvcj0iQWNrbm93bGVkZ2VtZW50cyIg
dGl0bGU9IkFja25vd2xlZGdlbWVudHMiPgogIDx0PgogICAgVEJECiAgPC90Pgo8L3NlY3Rpb24+
Cgo8c2VjdGlvbiBhbmNob3I9IklBTkEiIHRpdGxlPSJJQU5BIENvbnNpZGVyYXRpb25zIj4KICA8
dD5UaGlzIG1lbW8gaW5jbHVkZXMgbm8gcmVxdWVzdCB0byBJQU5BLjwvdD4KPC9zZWN0aW9uPgoK
PHNlY3Rpb24gdGl0bGUgPSAiU2VjdXJpdHkgQ29uc2lkZXJhdGlvbnMiPgogIDx0PgogICAgVEJE
ICAgICAgCiAgPC90Pgo8L3NlY3Rpb24+CjxzZWN0aW9uIHRpdGxlID0gIlByaXZhY3kgQ29uc2lk
ZXJhdGlvbnMiPgogIDx0PgogICAgVEJEICAgICAgCiAgPC90Pgo8L3NlY3Rpb24+CjwvbWlkZGxl
PgoKPGJhY2s+CiAgPHJlZmVyZW5jZXMgdGl0bGU9IkluZm9ybWF0aXZlIFJlZmVyZW5jZXMiPgog
ICAgJlJGQzUyODA7CiAgICAmUkZDNTkwNTsKICAgICZSRkM3Mzg0OwogICAgJlJGQzgxNzQ7CiAg
ICAmUkZDMjExOTsKICAgICZSRkMwMDIwOwogICAgCiAgICA8cmVmZXJlbmNlIGFuY2hvcj0iU0VD
TlRQIiB0YXJnZXQ9Imh0dHA6Ly9lcHJpbnQuaWFjci5vcmcvMjAxNi8xMDA2Ij4KICAgICAgPGZy
b250PgogICAgICAgIDx0aXRsZT5UaGUgU2VjdXJpdHkgb2YgTlRQJ3MgRGF0YWdyYW0gUHJvdG9j
b2w8L3RpdGxlPgogICAgICAgIAogICAgICAgIDxhdXRob3IgaW5pdGlhbHM9IkEuIiBzdXJuYW1l
PSJNYWxob3RyYSIgZnVsbG5hbWU9IkEuIE1hbGhvdHJhIj4KICAgICAgICAgICAgPG9yZ2FuaXph
dGlvbi8+CiAgICAgICAgPC9hdXRob3I+CiAgICAgICAgPGF1dGhvciBpbml0aWFscz0iTS4gVi4i
IHN1cm5hbWU9Ikd1bmR5IiBmdWxsbmFtZT0iTS4gVi4gR3VuZHkiPgogICAgICAgICAgPG9yZ2Fu
aXphdGlvbi8+CiAgICAgICAgPC9hdXRob3I+CiAgICAgICAgPGF1dGhvciBpbml0aWFscz0iTS4i
IHN1cm5hbWU9IlZhcmlhIiBmdWxsbmFtZT0iTS4gVmFyaWEiPgogICAgICAgICAgPG9yZ2FuaXph
dGlvbi8+CiAgICAgICAgPC9hdXRob3I+CiAgICAgICAgPGF1dGhvciBpbml0aWFscz0iSC4iIHN1
cm5hbWU9Iktlbm5lZHkiIGZ1bGxuYW1lPSJILiBLZW5uZWR5Ij4KICAgICAgICAgIDxvcmdhbml6
YXRpb24vPgogICAgICAgIDwvYXV0aG9yPgogICAgICAgIDxhdXRob3IgaW5pdGlhbHM9IkouIiBz
dXJuYW1lPSJHYXJkbmVyIiBmdWxsbmFtZT0iSi4gR2FyZG5lciI+CiAgICAgICAgICA8b3JnYW5p
emF0aW9uLz4KICAgICAgICAgIDwvYXV0aG9yPgogICAgICAgICAgPGF1dGhvciBpbml0aWFscz0i
Uy4iIHN1cm5hbWU9IkdvbGRiZXJnIiBmdWxsbmFtZT0iUy4gR29sZGJlcmciPgogICAgICAgICAg
ICA8b3JnYW5pemF0aW9uLz4KICAgICAgICAgIDwvYXV0aG9yPgogICAgICAgICAgPGRhdGUgeWVh
cj0iMjAxNiIvPgogICAgICA8L2Zyb250PgogICAgPC9yZWZlcmVuY2U+CiAgICAKICAgIDxyZWZl
cmVuY2UgYW5jaG9yPSJNQ0JHIiB0YXJnZXQ9Imh0dHBzOi8vZXByaW50LmlhY3Iub3JnLzIwMTUv
MTAyMCI+CiAgICAgIDxmcm9udD4KICAgICAgICA8dGl0bGU+QXR0YWNraW5nIHRoZSBOZXR3b3Jr
IFRpbWUgUHJvdG9jb2w8L3RpdGxlPgogICAgICAgIAogICAgICAgIDxhdXRob3IgaW5pdGlhbHM9
IkEuIiBzdXJuYW1lPSJNYWxob3RyYSIgZnVsbG5hbWU9IkEuIE1hbGhvdHJhIj4KICAgICAgICAg
IDxvcmdhbml6YXRpb24vPgogICAgICAgIDwvYXV0aG9yPgogICAgICAgIDxhdXRob3IgaW5pdGlh
bHM9IkkuIiBzdXJuYW1lPSJDb2hlbiIgZnVsbG5hbWU9IkkuIENvaGVuIj4KICAgICAgICAgIDxv
cmdhbml6YXRpb24vPgogICAgICAgIDwvYXV0aG9yPgogICAgICAgIDxhdXRob3IgaW5pdGlhbHM9
IkUuIiBzdXJuYW1lPSJCcmFra2UiIGZ1bGxuYW1lPSJFLiBCcmFra2UiPgogICAgICAgICAgPG9y
Z2FuaXphdGlvbi8+CiAgICAgICAgPC9hdXRob3I+CiAgICAgICAgPGF1dGhvciBpbml0aWFscz0i
Uy4iIHN1cm5hbWU9IkdvbGRiZXJnIiBmdWxsbmFtZT0iUy4gR29sZGJlcmciPgogICAgICAgICAg
PG9yZ2FuaXphdGlvbi8+CiAgICAgICAgPC9hdXRob3I+CiAgICAgICAgCiAgICAgICAgPGRhdGUg
eWVhcj0iMjAxNSIvPgogICAgICA8L2Zyb250PgogICAgPC9yZWZlcmVuY2U+CiAgICA8cmVmZXJl
bmNlIGFuY2hvcj0iQ0xPQ0tEUklGVCIgdGFyZ2V0PSJodHRwOi8vZG93bmxvYWRzLmhpbmRhd2ku
Y29tL2pvdXJuYWxzL2pjbmMvMjAwOC81ODMxNjIucGRmIj4KICAgICAgPGZyb250PgogICAgICAg
IDx0aXRsZT5JbnRlcm5hbCBjbG9jayBkcmlmdCBlc3RpbWF0aW9uIGluIGNvbXB1dGVyIGNsdXN0
ZXJzPC90aXRsZT4KICAgICAgICAKICAgICAgICA8YXV0aG9yIGluaXRpYWxzPSJILiIgc3VybmFt
ZT0iTWFyb3VhbmkiIGZ1bGxuYW1lPSJILiBNYXJvdWFuaSI+CiAgICAgICAgICA8b3JnYW5pemF0
aW9uLz4KICAgICAgICA8L2F1dGhvcj4KICAgICAgICA8YXV0aG9yIGluaXRpYWxzPSJNLiBSLiIg
c3VybmFtZT0iRGFnZW5haXMiIGZ1bGxuYW1lPSJNLiBSLiBEYWdlbmFpcyI+CiAgICAgICAgICA8
b3JnYW5pemF0aW9uLz4KICAgICAgICA8L2F1dGhvcj4KICAgICAgICA8ZGF0ZSB5ZWFyPSIyMDA4
Ii8+CiAgICAgIDwvZnJvbnQ+CiAgICA8L3JlZmVyZW5jZT4KICA8L3JlZmVyZW5jZXM+CjwvYmFj
az4KPC9yZmM+Cg==
--00000000000080482905812992db--


From nobody Tue Feb  5 10:18:04 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id A54EE131190 for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 10:18:02 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id WJwmLWs1eTc1 for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 10:18:01 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 56A3413118D for <xml2rfc@ietf.org>; Tue,  5 Feb 2019 10:18:01 -0800 (PST)
Received: from localhost ([::1]:39894 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gr5IG-0000Zk-JB; Tue, 05 Feb 2019 10:18:00 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com
X-Trac-Project: xml2rfc
Date: Tue, 05 Feb 2019 18:18:00 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/392#comment:1
Message-ID: <075.203bf2df6d4cee5b47b41148e2adb38d@tools.ietf.org>
References: <060.a75fce1ab1ed90ba9b52074db0d7ce99@tools.ietf.org>
X-Trac-Ticket-ID: 392
In-Reply-To: <060.a75fce1ab1ed90ba9b52074db0d7ce99@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/rgHixMI47Oaodobqdcp055_idec>
Subject: Re: [xml2rfc] #392 (Version 2 cli): xml2rfc no longer works on Mac, apparently related to SVG processing
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 05 Feb 2019 18:18:03 -0000

#392: xml2rfc no longer works on Mac, apparently related to SVG processing


Comment (by henrik@levkowetz.com):

 Ugh.  This is down in the python 3.7 libs, so it's a problem not only for
 {{{xml2rfc}}}.

 Nevertheless, it would be best to find a decent workaround for
 {{{xml2rfc}}} specifically.

 I've been trying to reproduce this here, but haven't had success with just
 setting the {{{LANG}}} environment variable as you have it; could you
 provide the source file which triggers this, and the command line switches
 used, please?

-- 
----------------------------+----------------------------------
  Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
      Type:  defect         |     Status:  new
  Priority:  blocker        |  Milestone:
 Component:  Version 2 cli  |    Version:  2.10.x
Resolution:                 |   Keywords:
----------------------------+----------------------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/392#comment:1>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Tue Feb  5 10:50:30 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 95769130EB4 for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 10:50:28 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=unavailable autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id U1KQ26mdfBLL for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 10:50:26 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 662FF130EB0 for <xml2rfc@ietf.org>; Tue,  5 Feb 2019 10:50:26 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:56187 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gr5nd-0003Qs-Ck; Tue, 05 Feb 2019 10:50:26 -0800
To: Watson Ladd <watson=40cloudflare.com@dmarc.ietf.org>, xml2rfc@ietf.org
References: <CAN2QdAHVNyYA4UP3-1UBbbaJwsu3+FP5Ro3BLm4OYqY=nYQrpw@mail.gmail.com>
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <ea3bda0d-5761-08f9-bdef-c3397e366695@levkowetz.com>
Date: Tue, 5 Feb 2019 19:50:18 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <CAN2QdAHVNyYA4UP3-1UBbbaJwsu3+FP5Ro3BLm4OYqY=nYQrpw@mail.gmail.com>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="wNoPbAUS99a4XxX7CNpl1PmA8kjB3VLmj"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, watson=40cloudflare.com@dmarc.ietf.org
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/bb6IhhTgti2qypTMl9ahYyjCTt4>
Subject: Re: [xml2rfc] Trying to cite RFC 20 produces errors
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 05 Feb 2019 18:50:29 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--wNoPbAUS99a4XxX7CNpl1PmA8kjB3VLmj
Content-Type: multipart/mixed; boundary="uEnlqjrRr2URFbajcxWvnRs5Q5hHJTKrL";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Watson Ladd <watson=40cloudflare.com@dmarc.ietf.org>, xml2rfc@ietf.org
Message-ID: <ea3bda0d-5761-08f9-bdef-c3397e366695@levkowetz.com>
Subject: Re: [xml2rfc] Trying to cite RFC 20 produces errors
References: <CAN2QdAHVNyYA4UP3-1UBbbaJwsu3+FP5Ro3BLm4OYqY=nYQrpw@mail.gmail.com>
In-Reply-To: <CAN2QdAHVNyYA4UP3-1UBbbaJwsu3+FP5Ro3BLm4OYqY=nYQrpw@mail.gmail.com>

--uEnlqjrRr2URFbajcxWvnRs5Q5hHJTKrL
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable

Hi,

On line 13 of your file, please change "http:///xml2rfc.ietf.org" (three
slashes) to "http://xml2rfc.ietf.org" (two slashes).  Or even better, use=

"https://xml2rfc.ietf.org" (two slashes).

Regards,

	Henrik

On 2019-02-05 19:13, Watson Ladd wrote:
> Dear XML2RFC people,
>=20
> I am trying to cite RFC 20. Despite the URL in the entity definition
> in the head, http:///xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0=
020.xml,
> pointing me to the right thing,
> the xml2rfc tool produces an error:
>=20
> Parsing file INPUT
> Resolving entity...
> /usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629.dtd
> Resolving entity...
> /usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629-xhtml.=
ent
> Resolving entity...
> /usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629-other.=
ent
> Resolving entity...
> /usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629.dtd
> Resolving entity...
> /usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629-xhtml.=
ent
> Resolving entity...
> /usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629-other.=
ent
> Resolving entity...
> http://xml.resource.org/public/rfc/bibxml/reference.RFC.5280.xml
> Loaded from cache reference.RFC.5280.xml
> Resolving entity...
> http://xml.resource.org/public/rfc/bibxml/reference.RFC.5905.xml
> Loaded from cache reference.RFC.5905.xml
> Resolving entity...
> http://xml.resource.org/public/rfc/bibxml/reference.RFC.7384.xml
> Loaded from cache reference.RFC.7384.xml
> Resolving entity...
> http://xml.resource.org/public/rfc/bibxml/reference.RFC.8174.xml
> Loaded from cache reference.RFC.8174.xml
> Resolving entity...
> http://xml.resource.org/public/rfc/bibxml/reference.RFC.2119.xml
> Loaded from cache reference.RFC.2119.xml
> Resolving entity...
> https://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:=
/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
>  ... 400 https://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2=
rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> URL retrieval failed with status code 400 for
> 'https://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http=
:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml'
> Resolving entity...
> https://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc=
/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
>  ... 400 https://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tool=
s/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml=

> URL retrieval failed with status code 400 for
> 'https://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rf=
c/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml'
> Resolving entity...
> http://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/=
xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
>  ... 400 http://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2r=
fc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> URL retrieval failed with status code 400 for
> 'http://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:=
/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml'
> Resolving entity...
> http://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/=
http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
>  ... 400 http://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools=
/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> URL retrieval failed with status code 400 for
> 'http://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc=
/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml'
> Error: Unable to resolve external request:
> "../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/=
public/rfc/bibxml/reference.RFC.0020.xml",
> trying the following location(s):
>     /home/www/tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml/../../=
=2E./home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/=
rfc/bibxml/reference.RFC.0020.xml
>     /home/www/tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml2/../..=
/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/r=
fc/bibxml/reference.RFC.0020.xml
>     /home/www/tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml3/../..=
/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/r=
fc/bibxml/reference.RFC.0020.xml
>     /home/www/tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml4/../..=
/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/r=
fc/bibxml/reference.RFC.0020.xml
>     /home/www/tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml5/../..=
/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/r=
fc/bibxml/reference.RFC.0020.xml
>     /home/www/tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml6/../..=
/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/r=
fc/bibxml/reference.RFC.0020.xml
>     /home/www/tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml7/../..=
/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/r=
fc/bibxml/reference.RFC.0020.xml
>     /home/www/tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml8/../..=
/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/r=
fc/bibxml/reference.RFC.0020.xml
>     https://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/h=
ttp:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
>     https://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml=
2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
>     http://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/ht=
tp:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
>     http://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2=
rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> Error: Unable to parse the XML document: INPUT
>  <string>: Line 238: Failure to process entity RFC0020
>  <string>: Line 238: Entity 'RFC0020' not defined
>=20
> Please let me know what I'm doing wrong. I'm happy to minimize the
> input on request.
>=20
> Sincerely,
> Watson Ladd
>=20
>=20
>=20
> _______________________________________________
> xml2rfc mailing list
> xml2rfc@ietf.org
> https://www.ietf.org/mailman/listinfo/xml2rfc
>=20


--uEnlqjrRr2URFbajcxWvnRs5Q5hHJTKrL--

--wNoPbAUS99a4XxX7CNpl1PmA8kjB3VLmj
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxZ2uoACgkQTptXS4+7
FxodSg/+JaWdFdgnjrtUZVMWRoo2yA8JAO+AJN+uQ2EAtV2dNhCrMZzSwMbrgnXV
ejgj7rcsiVmH167K0LxFMXNgMSf/IYSocus+i0tFqgmL/iqQEPEE5lX8Zr31S6KL
l8nMVkV6rxOS92fz4S23+DZeGnuFCxGhJ4GZBMuk6feXrIo/uEOkxUQeWe5BFyHP
C2QJiM5wnXOEVvGnZbN7exOccxLXZStSSzYKXsBsOW1F5t+pZKP1p+KVOM7QodZ1
D6h2pevv0BZ+33iSs9huKQ5r1lf3Ww/fPTqJwyv40cVjG+YXzhlFnNsvmPPWD55u
9vjQbah0G9efiJf4K+NErhzfOYIMXkzIeFoEtoc79fltxX5bfPrK/OdDIQnR313G
bTBnUSM2cSKbFxKdhKpqsvEdJDUvret/VrNP5PsJT/cCWhxo6i/Htzw/xcyi32SW
QuF3eKBCRHPwQcjyRMgw1S5pC9IMmYqbGWu4RfDmHPmSdCaafpT1cF7EZlEEm6/R
4h5Kok1swyP9lyXUYGx8X4jGbAZVrVn4tW17j7w97lIb/SpTYVUxioxHRaC3pvTx
Zm3JTyfJyVzFMxK2HwKZBLbYLICFXaHZwF/LVwjmUshwreCs47eE5XqNnMDSlruv
hoCXEIK+1zpVp8a/6HhQwHz8iYjL3OE7p7CdIps9GkFf0B4RZCU=
=4Aay
-----END PGP SIGNATURE-----

--wNoPbAUS99a4XxX7CNpl1PmA8kjB3VLmj--


From nobody Tue Feb  5 10:55:37 2019
Return-Path: <cabo@tzi.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id D2EAB130EB1 for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 10:55:35 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -3.178
X-Spam-Level: 
X-Spam-Status: No, score=-3.178 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, MISSING_HEADERS=1.021, RCVD_IN_DNSWL_MED=-2.3, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id p0WC3ERXCVQ1 for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 10:55:32 -0800 (PST)
Received: from mailhost.informatik.uni-bremen.de (mailhost.informatik.uni-bremen.de [IPv6:2001:638:708:30c9::12]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 2C9C812008F for <xml2rfc@ietf.org>; Tue,  5 Feb 2019 10:55:32 -0800 (PST)
X-Virus-Scanned: amavisd-new at informatik.uni-bremen.de
Received: from submithost.informatik.uni-bremen.de (submithost2.informatik.uni-bremen.de [IPv6:2001:638:708:30c8:406a:91ff:fe74:f2b7]) by mailhost.informatik.uni-bremen.de (8.14.5/8.14.5) with ESMTP id x15ItNxZ001703; Tue, 5 Feb 2019 19:55:28 +0100 (CET)
Received: from [192.168.217.106] (p54A6CC50.dip0.t-ipconnect.de [84.166.204.80]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by submithost.informatik.uni-bremen.de (Postfix) with ESMTPSA id 43vDKl17f1z1Br6; Tue,  5 Feb 2019 19:55:23 +0100 (CET)
Content-Type: text/plain; charset=utf-8
Mime-Version: 1.0 (Mac OS X Mail 11.5 \(3445.9.1\))
From: Carsten Bormann <cabo@tzi.org>
In-Reply-To: <060.a75fce1ab1ed90ba9b52074db0d7ce99@tools.ietf.org>
Date: Tue, 5 Feb 2019 19:55:22 +0100
Cc: Henrik Levkowetz <henrik@levkowetz.com>, xml2rfc@ietf.org
X-Mao-Original-Outgoing-Id: 571085720.372931-320a7fb5ee136a93cbe728ffc98cec6f
Content-Transfer-Encoding: quoted-printable
Message-Id: <71F6014B-6382-482B-A477-0CB97250DD4B@tzi.org>
References: <060.a75fce1ab1ed90ba9b52074db0d7ce99@tools.ietf.org>
X-Mailer: Apple Mail (2.3445.9.1)
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/LYdY1nL3EnvKkRYpfz0G-gExBTo>
Subject: Re: [xml2rfc] #392 (Version 2 cli): xml2rfc no longer works on Mac, apparently related to SVG processing
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 05 Feb 2019 18:55:36 -0000

It doesn=E2=80=99t get to the source file; I can reproduce this with

LANG=3D"en_US@calendar=3Diso8601.UTF-8=E2=80=9D xml2rfc foo.bar

er, and with

LANG=3D=E2=80=9CC=E2=80=9D xml2rfc foo.bar

Hmm.  This is getting interesting.

Setting LC_ALL to a valid locale (including the above) fixes this.

Maybe I don=E2=80=99t understand where the locale comes from if =
LC_ALL=3D=E2=80=9C=E2=80=9D

More fun:

{{{
$ locale
LANG=3D"en_US.UTF-8"
LC_COLLATE=3D"en_US.UTF-8"
LC_CTYPE=3D"en_US.UTF-8"
LC_MESSAGES=3D"en_US.UTF-8"
LC_MONETARY=3D"en_US.UTF-8"
LC_NUMERIC=3D"en_US.UTF-8"
LC_TIME=3D"en_US.UTF-8"
LC_ALL=3D
$ xml2rfc foo.bar
No such file: foo.bar
$ LANG=3DC xml2rfc foo.bar
Traceback (most recent call last):
  File "/Users/cabo/bin/xml2rfc", line 7, in <module>
    from xml2rfc.run import main
  File "/Users/cabo/lib/python3.7/site-packages/xml2rfc/__init__.py", =
line 14, in <module>
    from xml2rfc.parser import  XmlRfcError, CachingResolver, =
XmlRfcParser, XmlRfc
  File "/Users/cabo/lib/python3.7/site-packages/xml2rfc/parser.py", line =
17, in <module>
    from xml2rfc.writers import base
  File =
"/Users/cabo/lib/python3.7/site-packages/xml2rfc/writers/__init__.py", =
line 14, in <module>
    from xml2rfc.writers.pdf import PdfWriter
  File "/Users/cabo/lib/python3.7/site-packages/xml2rfc/writers/pdf.py", =
line 15, in <module>
    import weasyprint
  File "/Users/cabo/lib/python3.7/site-packages/weasyprint/__init__.py", =
line 393, in <module>
    from .css import preprocess_stylesheet  # noqa
  File =
"/Users/cabo/lib/python3.7/site-packages/weasyprint/css/__init__.py", =
line 25, in <module>
    from . import computed_values
  File =
"/Users/cabo/lib/python3.7/site-packages/weasyprint/css/computed_values.py=
", line 21, in <module>
    from .utils import (
  File =
"/Users/cabo/lib/python3.7/site-packages/weasyprint/css/utils.py", line =
20, in <module>
    from ..images import LinearGradient, RadialGradient
  File "/Users/cabo/lib/python3.7/site-packages/weasyprint/images.py", =
line 17, in <module>
    import cairosvg.parser
  File "/Users/cabo/lib/python3.7/site-packages/cairosvg/__init__.py", =
line 41, in <module>
    from . import surface  # noqa
  File "/Users/cabo/lib/python3.7/site-packages/cairosvg/surface.py", =
line 27, in <module>
    from .defs import (
  File "/Users/cabo/lib/python3.7/site-packages/cairosvg/defs.py", line =
24, in <module>
    from .bounding_box import calculate_bounding_box, =
is_non_empty_bounding_box
  File =
"/Users/cabo/lib/python3.7/site-packages/cairosvg/bounding_box.py", line =
26, in <module>
    from .features import match_features
  File "/Users/cabo/lib/python3.7/site-packages/cairosvg/features.py", =
line 25, in <module>
    LOCALE =3D locale.getdefaultlocale()[0] or ''
  File =
"/Users/cabo/.homebrew/Cellar/python/3.7.2_1/Frameworks/Python.framework/V=
ersions/3.7/lib/python3.7/locale.py", line 568, in getdefaultlocale
    return _parse_localename(localename)
  File =
"/Users/cabo/.homebrew/Cellar/python/3.7.2_1/Frameworks/Python.framework/V=
ersions/3.7/lib/python3.7/locale.py", line 495, in _parse_localename
    raise ValueError('unknown locale: %s' % localename)
ValueError: unknown locale: UTF-8
}}}

Unfortunately, the logic in locale.py is pure spaghetti.
getdefaultlocale seems to pull =E2=80=9CUTF-8" out of envvars that are =
explicitly being overridden.

Gr=C3=BC=C3=9Fe, Carsten



> On Feb 4, 2019, at 21:41, xml2rfc issue tracker <trac@tools.ietf.org> =
wrote:
>=20
> #392: xml2rfc no longer works on Mac, apparently related to SVG =
processing
>=20
> Macs configured for standard weeks tend to have an ugly locale such =
as:
>=20
> {{{
>  LANG=3D"en_US@calendar=3Diso8601.UTF-8"
> }}}
>=20
> (Spare me the words about Apple hiding this necessary, =
should-be-default
> configuration in the locale.)
>=20
> xml2rfc now croaks with
>=20
> {{{
> Traceback (most recent call last):
>   File "/Users/cabo/bin/xml2rfc", line 7, in <module>
>     from xml2rfc.run import main
>   File "/Users/cabo/lib/python3.7/site-packages/xml2rfc/__init__.py", =
line
> 14, in <module>
>     from xml2rfc.parser import  XmlRfcError, CachingResolver,
> XmlRfcParser, XmlRfc
>   File "/Users/cabo/lib/python3.7/site-packages/xml2rfc/parser.py", =
line
> 17, in <module>
>     from xml2rfc.writers import base
>   File "/Users/cabo/lib/python3.7/site-
> packages/xml2rfc/writers/__init__.py", line 14, in <module>
>     from xml2rfc.writers.pdf import PdfWriter
>   File =
"/Users/cabo/lib/python3.7/site-packages/xml2rfc/writers/pdf.py",
> line 15, in <module>
>     import weasyprint
>   File =
"/Users/cabo/lib/python3.7/site-packages/weasyprint/__init__.py",
> line 393, in <module>
>     from .css import preprocess_stylesheet  # noqa
>   File "/Users/cabo/lib/python3.7/site-
> packages/weasyprint/css/__init__.py", line 25, in <module>
>     from . import computed_values
>   File "/Users/cabo/lib/python3.7/site-
> packages/weasyprint/css/computed_values.py", line 21, in <module>
>     from .utils import (
>   File =
"/Users/cabo/lib/python3.7/site-packages/weasyprint/css/utils.py",
> line 20, in <module>
>     from ..images import LinearGradient, RadialGradient
>   File "/Users/cabo/lib/python3.7/site-packages/weasyprint/images.py",
> line 17, in <module>
>     import cairosvg.parser
>   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/__init__.py",
> line 41, in <module>
>     from . import surface  # noqa
>   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/surface.py", =
line
> 27, in <module>
>     from .defs import (
>   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/defs.py", =
line
> 24, in <module>
>     from .bounding_box import calculate_bounding_box,
> is_non_empty_bounding_box
>   File =
"/Users/cabo/lib/python3.7/site-packages/cairosvg/bounding_box.py",
> line 26, in <module>
>     from .features import match_features
>   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/features.py",
> line 25, in <module>
>     LOCALE =3D locale.getdefaultlocale()[0] or ''
>   File
> =
"/Users/cabo/.homebrew/Cellar/python/3.7.2_1/Frameworks/Python.framework/V=
ersions/3.7/lib/python3.7/locale.py",
> line 568, in getdefaultlocale
>     return _parse_localename(localename)
>   File
> =
"/Users/cabo/.homebrew/Cellar/python/3.7.2_1/Frameworks/Python.framework/V=
ersions/3.7/lib/python3.7/locale.py",
> line 495, in _parse_localename
>     raise ValueError('unknown locale: %s' % localename)
> ValueError: unknown locale: UTF-8
>=20
> *** xml2rfc failed, status 1 (possibly try with -r)
> }}}
>=20
> --=20
> ---------------------------+----------------------------------
> Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
>     Type:  defect         |     Status:  new
> Priority:  blocker        |  Milestone:
> Component:  Version 2 cli  |    Version:  2.10.x
> Keywords:                 |
> ---------------------------+----------------------------------
>=20
> Ticket URL: =
<https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/392>
> xml2rfc <http://tools.ietf.org/tools/xml2rfc/>
>=20
>=20


From nobody Tue Feb  5 11:07:22 2019
Return-Path: <agmalis@gmail.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 2F9B1130EC5 for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 11:07:21 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.998
X-Spam-Level: 
X-Spam-Status: No, score=-1.998 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, FREEMAIL_FROM=0.001, HTML_MESSAGE=0.001, RCVD_IN_DNSWL_NONE=-0.0001, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (2048-bit key) header.d=gmail.com
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id p7UcGJjZboWw for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 11:07:18 -0800 (PST)
Received: from mail-qk1-x736.google.com (mail-qk1-x736.google.com [IPv6:2607:f8b0:4864:20::736]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 29286130ED6 for <xml2rfc@ietf.org>; Tue,  5 Feb 2019 11:07:18 -0800 (PST)
Received: by mail-qk1-x736.google.com with SMTP id a15so2796744qkc.1 for <xml2rfc@ietf.org>; Tue, 05 Feb 2019 11:07:18 -0800 (PST)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025;  h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=1uUI9Fy2JIV/0Flyu9TY3VnPm7mLf53jWC5WvhLGaRQ=; b=fJRXGKxbYBRUUjK53t/nltWqXTAdzR8Y2IG3xN6kB1z6ashwKYhgOrEdedjpZakxB+ I1s7YjwZ/+CSaAc3z7QKjwSH7iaquUhXAoSd05ufUeDB13I6Baj8hjhLvxUmQZ5Wp/rB ynNnh8MnBoUW9WqqkgrCutNdfF9K/49DNo74EJWn2XeEdMcpmZeM7bP3rc6S6s/gJFKP HStmGEATDRuucCbD+cAftPmZSTdWfQ/aSrvCWiViMHX805cUSkwOJGOcLOrycgZPduRq KePfec2svE2QmJ6oYzdznNydhXjyFBq8Mh5Ug8UAfs/WB/6YqjTG5ODz2UMW2gzrv2I0 DDZg==
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=1uUI9Fy2JIV/0Flyu9TY3VnPm7mLf53jWC5WvhLGaRQ=; b=pBZ1f70SX5LwZTUITKkGt+C+O1NhB4k8QeJvlMU/IGXlYrNuohfYJspD5Dalt0tHI0 DwKJLkp+G2sCQY15emD50ZZDIk4Ox7t2yZlY2/nwUak/EfQZzn7J/ybOMj98MrJHRCGp ONlDsVjIS7VsRKaHbWm4uVWhIYM+MobS0x3yLQ/rkYWRH670OckA4/QjbLO51DcFvna+ 7fcuiwWe3H0jpcoyKtqL6OeQfjdTE7VPYKv7P8yJXANHXYU+hzqyw9qL6ddtQP2IDWhp JCTg16M/EvR1naC193GycEcvYShz9IIT3kwcVEMiLTBKzYqbTF2sJZHf470vmEbOgfwg PxDw==
X-Gm-Message-State: AHQUAua6ENtc2IlD3cb+f76fXtHBcTWdeQk+HkAkq7a1M41mnBiY+uWB jogzZ8/Pl2tk0rTqGAAPpqIApQiSz0aXNi3aFHOjvpUM
X-Google-Smtp-Source: AHgI3IaTbOTQO2rzWGocFeVj8dAnFemBpIYLrUPd4E1ZZavhgXTcfnA0ZaYhXuazxpZE1zhyCCee09P7167DIQbQsLY=
X-Received: by 2002:a37:5945:: with SMTP id n66mr4719202qkb.231.1549393637136;  Tue, 05 Feb 2019 11:07:17 -0800 (PST)
MIME-Version: 1.0
References: <CAN2QdAHVNyYA4UP3-1UBbbaJwsu3+FP5Ro3BLm4OYqY=nYQrpw@mail.gmail.com> <ea3bda0d-5761-08f9-bdef-c3397e366695@levkowetz.com>
In-Reply-To: <ea3bda0d-5761-08f9-bdef-c3397e366695@levkowetz.com>
From: "Andrew G. Malis" <agmalis@gmail.com>
Date: Tue, 5 Feb 2019 14:07:06 -0500
Message-ID: <CAA=duU2cpnQrYe1ob=FA3nhTHchq1_59++Uu9SRhuwDGVd=Org@mail.gmail.com>
To: Henrik Levkowetz <henrik@levkowetz.com>
Cc: Watson Ladd <watson=40cloudflare.com@dmarc.ietf.org>, xml2rfc@ietf.org
Content-Type: multipart/alternative; boundary="0000000000005bdcac05812a5148"
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/Qwx-jsXMztlQXGRtrhNiIj5ODrU>
Subject: Re: [xml2rfc] Trying to cite RFC 20 produces errors
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 05 Feb 2019 19:07:21 -0000

--0000000000005bdcac05812a5148
Content-Type: text/plain; charset="UTF-8"

Or, the following works for me:

In the text:

<t>
This is a reference to RFC 20 <xref target="RFC0020"/>.
</t>

At the bottom:

<back>
    <references title="Normative References">
    <?rfc include="reference.RFC.0020"?>
    </references>
</back>

Cheers,
Andy



On Tue, Feb 5, 2019 at 1:50 PM Henrik Levkowetz <henrik@levkowetz.com>
wrote:

> Hi,
>
> On line 13 of your file, please change "http:///xml2rfc.ietf.org" (three
> slashes) to "http://xml2rfc.ietf.org" (two slashes).  Or even better, use
> "https://xml2rfc.ietf.org" (two slashes).
>
> Regards,
>
>         Henrik
>
> On 2019-02-05 19:13, Watson Ladd wrote:
> > Dear XML2RFC people,
> >
> > I am trying to cite RFC 20. Despite the URL in the entity definition
> > in the head, http:///
> xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml,
> > pointing me to the right thing,
> > the xml2rfc tool produces an error:
> >
> > Parsing file INPUT
> > Resolving entity...
> > /usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629.dtd
> > Resolving entity...
> >
> /usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629-xhtml.ent
> > Resolving entity...
> >
> /usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629-other.ent
> > Resolving entity...
> > /usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629.dtd
> > Resolving entity...
> >
> /usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629-xhtml.ent
> > Resolving entity...
> >
> /usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629-other.ent
> > Resolving entity...
> > http://xml.resource.org/public/rfc/bibxml/reference.RFC.5280.xml
> > Loaded from cache reference.RFC.5280.xml
> > Resolving entity...
> > http://xml.resource.org/public/rfc/bibxml/reference.RFC.5905.xml
> > Loaded from cache reference.RFC.5905.xml
> > Resolving entity...
> > http://xml.resource.org/public/rfc/bibxml/reference.RFC.7384.xml
> > Loaded from cache reference.RFC.7384.xml
> > Resolving entity...
> > http://xml.resource.org/public/rfc/bibxml/reference.RFC.8174.xml
> > Loaded from cache reference.RFC.8174.xml
> > Resolving entity...
> > http://xml.resource.org/public/rfc/bibxml/reference.RFC.2119.xml
> > Loaded from cache reference.RFC.2119.xml
> > Resolving entity...
> >
> https://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> >  ... 400
> https://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> > URL retrieval failed with status code 400 for
> > '
> https://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> '
> > Resolving entity...
> >
> https://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> >  ... 400
> https://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> > URL retrieval failed with status code 400 for
> > '
> https://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> '
> > Resolving entity...
> >
> http://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> >  ... 400
> http://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> > URL retrieval failed with status code 400 for
> > '
> http://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> '
> > Resolving entity...
> >
> http://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> >  ... 400
> http://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> > URL retrieval failed with status code 400 for
> > '
> http://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> '
> > Error: Unable to resolve external request:
> > "../../../home/www/
> tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> ",
> > trying the following location(s):
> >     /home/www/
> tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> >     /home/www/
> tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml2/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> >     /home/www/
> tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml3/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> >     /home/www/
> tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml4/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> >     /home/www/
> tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml5/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> >     /home/www/
> tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml6/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> >     /home/www/
> tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml7/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> >     /home/www/
> tools.ietf.org/tools/xml2rfc/web/public/rfc/bibxml8/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> >
> https://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> >
> https://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> >
> http://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> >
> http://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml
> > Error: Unable to parse the XML document: INPUT
> >  <string>: Line 238: Failure to process entity RFC0020
> >  <string>: Line 238: Entity 'RFC0020' not defined
> >
> > Please let me know what I'm doing wrong. I'm happy to minimize the
> > input on request.
> >
> > Sincerely,
> > Watson Ladd
> >
> >
> >
> > _______________________________________________
> > xml2rfc mailing list
> > xml2rfc@ietf.org
> > https://www.ietf.org/mailman/listinfo/xml2rfc
> >
>
> _______________________________________________
> xml2rfc mailing list
> xml2rfc@ietf.org
> https://www.ietf.org/mailman/listinfo/xml2rfc
>

--0000000000005bdcac05812a5148
Content-Type: text/html; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

<div dir=3D"ltr"><div dir=3D"ltr"><div dir=3D"ltr"><div dir=3D"ltr"><div di=
r=3D"ltr">Or, the following works for me:<div><br></div><div>In the text:</=
div><div><br></div><div><div>&lt;t&gt;</div><div>This is a reference to RFC=
 20 &lt;xref target=3D&quot;RFC0020&quot;/&gt;.</div><div>&lt;/t&gt;</div><=
/div><div><br></div><div>At the bottom:</div><div><br></div><div><div>&lt;b=
ack&gt;</div><div>=C2=A0 =C2=A0 &lt;references title=3D&quot;Normative Refe=
rences&quot;&gt;</div><div>=C2=A0 =C2=A0 &lt;?rfc include=3D&quot;reference=
.RFC.0020&quot;?&gt;</div><div>=C2=A0 =C2=A0 &lt;/references&gt;</div><div>=
&lt;/back&gt;</div><div><br></div></div><div>Cheers,</div><div>Andy</div><d=
iv><br></div><div><br></div></div></div></div></div></div><br><div class=3D=
"gmail_quote"><div dir=3D"ltr" class=3D"gmail_attr">On Tue, Feb 5, 2019 at =
1:50 PM Henrik Levkowetz &lt;<a href=3D"mailto:henrik@levkowetz.com">henrik=
@levkowetz.com</a>&gt; wrote:<br></div><blockquote class=3D"gmail_quote" st=
yle=3D"margin:0px 0px 0px 0.8ex;border-left:1px solid rgb(204,204,204);padd=
ing-left:1ex">Hi,<br>
<br>
On line 13 of your file, please change &quot;http:///<a href=3D"http://xml2=
rfc.ietf.org" rel=3D"noreferrer" target=3D"_blank">xml2rfc.ietf.org</a>&quo=
t; (three<br>
slashes) to &quot;<a href=3D"http://xml2rfc.ietf.org" rel=3D"noreferrer" ta=
rget=3D"_blank">http://xml2rfc.ietf.org</a>&quot; (two slashes).=C2=A0 Or e=
ven better, use<br>
&quot;<a href=3D"https://xml2rfc.ietf.org" rel=3D"noreferrer" target=3D"_bl=
ank">https://xml2rfc.ietf.org</a>&quot; (two slashes).<br>
<br>
Regards,<br>
<br>
=C2=A0 =C2=A0 =C2=A0 =C2=A0 Henrik<br>
<br>
On 2019-02-05 19:13, Watson Ladd wrote:<br>
&gt; Dear XML2RFC people,<br>
&gt; <br>
&gt; I am trying to cite RFC 20. Despite the URL in the entity definition<b=
r>
&gt; in the head, http:///<a href=3D"http://xml2rfc.ietf.org/public/rfc/bib=
xml/reference.RFC.0020.xml" rel=3D"noreferrer" target=3D"_blank">xml2rfc.ie=
tf.org/public/rfc/bibxml/reference.RFC.0020.xml</a>,<br>
&gt; pointing me to the right thing,<br>
&gt; the xml2rfc tool produces an error:<br>
&gt; <br>
&gt; Parsing file INPUT<br>
&gt; Resolving entity...<br>
&gt; /usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629.dtd<b=
r>
&gt; Resolving entity...<br>
&gt; /usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629-xhtml=
.ent<br>
&gt; Resolving entity...<br>
&gt; /usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629-other=
.ent<br>
&gt; Resolving entity...<br>
&gt; /usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629.dtd<b=
r>
&gt; Resolving entity...<br>
&gt; /usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629-xhtml=
.ent<br>
&gt; Resolving entity...<br>
&gt; /usr/local/lib/python2.7/dist-packages/xml2rfc/templates/rfc2629-other=
.ent<br>
&gt; Resolving entity...<br>
&gt; <a href=3D"http://xml.resource.org/public/rfc/bibxml/reference.RFC.528=
0.xml" rel=3D"noreferrer" target=3D"_blank">http://xml.resource.org/public/=
rfc/bibxml/reference.RFC.5280.xml</a><br>
&gt; Loaded from cache reference.RFC.5280.xml<br>
&gt; Resolving entity...<br>
&gt; <a href=3D"http://xml.resource.org/public/rfc/bibxml/reference.RFC.590=
5.xml" rel=3D"noreferrer" target=3D"_blank">http://xml.resource.org/public/=
rfc/bibxml/reference.RFC.5905.xml</a><br>
&gt; Loaded from cache reference.RFC.5905.xml<br>
&gt; Resolving entity...<br>
&gt; <a href=3D"http://xml.resource.org/public/rfc/bibxml/reference.RFC.738=
4.xml" rel=3D"noreferrer" target=3D"_blank">http://xml.resource.org/public/=
rfc/bibxml/reference.RFC.7384.xml</a><br>
&gt; Loaded from cache reference.RFC.7384.xml<br>
&gt; Resolving entity...<br>
&gt; <a href=3D"http://xml.resource.org/public/rfc/bibxml/reference.RFC.817=
4.xml" rel=3D"noreferrer" target=3D"_blank">http://xml.resource.org/public/=
rfc/bibxml/reference.RFC.8174.xml</a><br>
&gt; Loaded from cache reference.RFC.8174.xml<br>
&gt; Resolving entity...<br>
&gt; <a href=3D"http://xml.resource.org/public/rfc/bibxml/reference.RFC.211=
9.xml" rel=3D"noreferrer" target=3D"_blank">http://xml.resource.org/public/=
rfc/bibxml/reference.RFC.2119.xml</a><br>
&gt; Loaded from cache reference.RFC.2119.xml<br>
&gt; Resolving entity...<br>
&gt; <a href=3D"https://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/x=
ml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml" rel=
=3D"noreferrer" target=3D"_blank">https://xml2rfc.ietf.org/../home/www/tool=
s.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference=
.RFC.0020.xml</a><br>
&gt;=C2=A0 ... 400 <a href=3D"https://xml2rfc.ietf.org/../home/www/tools.ie=
tf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC=
.0020.xml" rel=3D"noreferrer" target=3D"_blank">https://xml2rfc.ietf.org/..=
/home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bi=
bxml/reference.RFC.0020.xml</a><br>
&gt; URL retrieval failed with status code 400 for<br>
&gt; &#39;<a href=3D"https://xml2rfc.ietf.org/../home/www/tools.ietf.org/to=
ols/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml=
" rel=3D"noreferrer" target=3D"_blank">https://xml2rfc.ietf.org/../home/www=
/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/refe=
rence.RFC.0020.xml</a>&#39;<br>
&gt; Resolving entity...<br>
&gt; <a href=3D"https://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/t=
ools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xm=
l" rel=3D"noreferrer" target=3D"_blank">https://xml2rfc.tools.ietf.org/../h=
ome/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibx=
ml/reference.RFC.0020.xml</a><br>
&gt;=C2=A0 ... 400 <a href=3D"https://xml2rfc.tools.ietf.org/../home/www/to=
ols.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/referen=
ce.RFC.0020.xml" rel=3D"noreferrer" target=3D"_blank">https://xml2rfc.tools=
.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/p=
ublic/rfc/bibxml/reference.RFC.0020.xml</a><br>
&gt; URL retrieval failed with status code 400 for<br>
&gt; &#39;<a href=3D"https://xml2rfc.tools.ietf.org/../home/www/tools.ietf.=
org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.00=
20.xml" rel=3D"noreferrer" target=3D"_blank">https://xml2rfc.tools.ietf.org=
/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc=
/bibxml/reference.RFC.0020.xml</a>&#39;<br>
&gt; Resolving entity...<br>
&gt; <a href=3D"http://xml2rfc.ietf.org/../home/www/tools.ietf.org/tools/xm=
l2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml" rel=
=3D"noreferrer" target=3D"_blank">http://xml2rfc.ietf.org/../home/www/tools=
.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.=
RFC.0020.xml</a><br>
&gt;=C2=A0 ... 400 <a href=3D"http://xml2rfc.ietf.org/../home/www/tools.iet=
f.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.=
0020.xml" rel=3D"noreferrer" target=3D"_blank">http://xml2rfc.ietf.org/../h=
ome/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibx=
ml/reference.RFC.0020.xml</a><br>
&gt; URL retrieval failed with status code 400 for<br>
&gt; &#39;<a href=3D"http://xml2rfc.ietf.org/../home/www/tools.ietf.org/too=
ls/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml"=
 rel=3D"noreferrer" target=3D"_blank">http://xml2rfc.ietf.org/../home/www/t=
ools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/refere=
nce.RFC.0020.xml</a>&#39;<br>
&gt; Resolving entity...<br>
&gt; <a href=3D"http://xml2rfc.tools.ietf.org/../home/www/tools.ietf.org/to=
ols/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml=
" rel=3D"noreferrer" target=3D"_blank">http://xml2rfc.tools.ietf.org/../hom=
e/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml=
/reference.RFC.0020.xml</a><br>
&gt;=C2=A0 ... 400 <a href=3D"http://xml2rfc.tools.ietf.org/../home/www/too=
ls.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/referenc=
e.RFC.0020.xml" rel=3D"noreferrer" target=3D"_blank">http://xml2rfc.tools.i=
etf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/pub=
lic/rfc/bibxml/reference.RFC.0020.xml</a><br>
&gt; URL retrieval failed with status code 400 for<br>
&gt; &#39;<a href=3D"http://xml2rfc.tools.ietf.org/../home/www/tools.ietf.o=
rg/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.002=
0.xml" rel=3D"noreferrer" target=3D"_blank">http://xml2rfc.tools.ietf.org/.=
./home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/b=
ibxml/reference.RFC.0020.xml</a>&#39;<br>
&gt; Error: Unable to resolve external request:<br>
&gt; &quot;../../../home/www/<a href=3D"http://tools.ietf.org/tools/xml2rfc=
/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml" rel=3D"no=
referrer" target=3D"_blank">tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf=
.org/public/rfc/bibxml/reference.RFC.0020.xml</a>&quot;,<br>
&gt; trying the following location(s):<br>
&gt;=C2=A0 =C2=A0 =C2=A0/home/www/<a href=3D"http://tools.ietf.org/tools/xm=
l2rfc/web/public/rfc/bibxml/../../../home/www/tools.ietf.org/tools/xml2rfc/=
http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml" rel=3D"nor=
eferrer" target=3D"_blank">tools.ietf.org/tools/xml2rfc/web/public/rfc/bibx=
ml/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/pu=
blic/rfc/bibxml/reference.RFC.0020.xml</a><br>
&gt;=C2=A0 =C2=A0 =C2=A0/home/www/<a href=3D"http://tools.ietf.org/tools/xm=
l2rfc/web/public/rfc/bibxml2/../../../home/www/tools.ietf.org/tools/xml2rfc=
/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml" rel=3D"no=
referrer" target=3D"_blank">tools.ietf.org/tools/xml2rfc/web/public/rfc/bib=
xml2/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/=
public/rfc/bibxml/reference.RFC.0020.xml</a><br>
&gt;=C2=A0 =C2=A0 =C2=A0/home/www/<a href=3D"http://tools.ietf.org/tools/xm=
l2rfc/web/public/rfc/bibxml3/../../../home/www/tools.ietf.org/tools/xml2rfc=
/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml" rel=3D"no=
referrer" target=3D"_blank">tools.ietf.org/tools/xml2rfc/web/public/rfc/bib=
xml3/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/=
public/rfc/bibxml/reference.RFC.0020.xml</a><br>
&gt;=C2=A0 =C2=A0 =C2=A0/home/www/<a href=3D"http://tools.ietf.org/tools/xm=
l2rfc/web/public/rfc/bibxml4/../../../home/www/tools.ietf.org/tools/xml2rfc=
/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml" rel=3D"no=
referrer" target=3D"_blank">tools.ietf.org/tools/xml2rfc/web/public/rfc/bib=
xml4/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/=
public/rfc/bibxml/reference.RFC.0020.xml</a><br>
&gt;=C2=A0 =C2=A0 =C2=A0/home/www/<a href=3D"http://tools.ietf.org/tools/xm=
l2rfc/web/public/rfc/bibxml5/../../../home/www/tools.ietf.org/tools/xml2rfc=
/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml" rel=3D"no=
referrer" target=3D"_blank">tools.ietf.org/tools/xml2rfc/web/public/rfc/bib=
xml5/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/=
public/rfc/bibxml/reference.RFC.0020.xml</a><br>
&gt;=C2=A0 =C2=A0 =C2=A0/home/www/<a href=3D"http://tools.ietf.org/tools/xm=
l2rfc/web/public/rfc/bibxml6/../../../home/www/tools.ietf.org/tools/xml2rfc=
/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml" rel=3D"no=
referrer" target=3D"_blank">tools.ietf.org/tools/xml2rfc/web/public/rfc/bib=
xml6/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/=
public/rfc/bibxml/reference.RFC.0020.xml</a><br>
&gt;=C2=A0 =C2=A0 =C2=A0/home/www/<a href=3D"http://tools.ietf.org/tools/xm=
l2rfc/web/public/rfc/bibxml7/../../../home/www/tools.ietf.org/tools/xml2rfc=
/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml" rel=3D"no=
referrer" target=3D"_blank">tools.ietf.org/tools/xml2rfc/web/public/rfc/bib=
xml7/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/=
public/rfc/bibxml/reference.RFC.0020.xml</a><br>
&gt;=C2=A0 =C2=A0 =C2=A0/home/www/<a href=3D"http://tools.ietf.org/tools/xm=
l2rfc/web/public/rfc/bibxml8/../../../home/www/tools.ietf.org/tools/xml2rfc=
/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference.RFC.0020.xml" rel=3D"no=
referrer" target=3D"_blank">tools.ietf.org/tools/xml2rfc/web/public/rfc/bib=
xml8/../../../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/=
public/rfc/bibxml/reference.RFC.0020.xml</a><br>
&gt;=C2=A0 =C2=A0 =C2=A0<a href=3D"https://xml2rfc.ietf.org/../home/www/too=
ls.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/referenc=
e.RFC.0020.xml" rel=3D"noreferrer" target=3D"_blank">https://xml2rfc.ietf.o=
rg/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/r=
fc/bibxml/reference.RFC.0020.xml</a><br>
&gt;=C2=A0 =C2=A0 =C2=A0<a href=3D"https://xml2rfc.tools.ietf.org/../home/w=
ww/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/re=
ference.RFC.0020.xml" rel=3D"noreferrer" target=3D"_blank">https://xml2rfc.=
tools.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.=
org/public/rfc/bibxml/reference.RFC.0020.xml</a><br>
&gt;=C2=A0 =C2=A0 =C2=A0<a href=3D"http://xml2rfc.ietf.org/../home/www/tool=
s.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/reference=
.RFC.0020.xml" rel=3D"noreferrer" target=3D"_blank">http://xml2rfc.ietf.org=
/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc=
/bibxml/reference.RFC.0020.xml</a><br>
&gt;=C2=A0 =C2=A0 =C2=A0<a href=3D"http://xml2rfc.tools.ietf.org/../home/ww=
w/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.org/public/rfc/bibxml/ref=
erence.RFC.0020.xml" rel=3D"noreferrer" target=3D"_blank">http://xml2rfc.to=
ols.ietf.org/../home/www/tools.ietf.org/tools/xml2rfc/http:/xml2rfc.ietf.or=
g/public/rfc/bibxml/reference.RFC.0020.xml</a><br>
&gt; Error: Unable to parse the XML document: INPUT<br>
&gt;=C2=A0 &lt;string&gt;: Line 238: Failure to process entity RFC0020<br>
&gt;=C2=A0 &lt;string&gt;: Line 238: Entity &#39;RFC0020&#39; not defined<b=
r>
&gt; <br>
&gt; Please let me know what I&#39;m doing wrong. I&#39;m happy to minimize=
 the<br>
&gt; input on request.<br>
&gt; <br>
&gt; Sincerely,<br>
&gt; Watson Ladd<br>
&gt; <br>
&gt; <br>
&gt; <br>
&gt; _______________________________________________<br>
&gt; xml2rfc mailing list<br>
&gt; <a href=3D"mailto:xml2rfc@ietf.org" target=3D"_blank">xml2rfc@ietf.org=
</a><br>
&gt; <a href=3D"https://www.ietf.org/mailman/listinfo/xml2rfc" rel=3D"noref=
errer" target=3D"_blank">https://www.ietf.org/mailman/listinfo/xml2rfc</a><=
br>
&gt; <br>
<br>
_______________________________________________<br>
xml2rfc mailing list<br>
<a href=3D"mailto:xml2rfc@ietf.org" target=3D"_blank">xml2rfc@ietf.org</a><=
br>
<a href=3D"https://www.ietf.org/mailman/listinfo/xml2rfc" rel=3D"noreferrer=
" target=3D"_blank">https://www.ietf.org/mailman/listinfo/xml2rfc</a><br>
</blockquote></div>

--0000000000005bdcac05812a5148--


From nobody Tue Feb  5 11:16:19 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id ADAB3130ECF for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 11:16:18 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id J9pIfwvTP4-h for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 11:16:16 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 62C22130ECD for <xml2rfc@ietf.org>; Tue,  5 Feb 2019 11:16:16 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:56410 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gr6Cd-0000uQ-99; Tue, 05 Feb 2019 11:16:16 -0800
To: Carsten Bormann <cabo@tzi.org>
References: <060.a75fce1ab1ed90ba9b52074db0d7ce99@tools.ietf.org> <71F6014B-6382-482B-A477-0CB97250DD4B@tzi.org>
Cc: xml2rfc@ietf.org
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <44ce0a27-71c4-9dae-eee6-a06368576198@levkowetz.com>
Date: Tue, 5 Feb 2019 20:16:07 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <71F6014B-6382-482B-A477-0CB97250DD4B@tzi.org>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="Jkuiifu2aEXSulAd3N2GTUdgJ2vovK4W0"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, cabo@tzi.org
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/ed0nVDBV1zIWfY-LeWSd8enhyO4>
Subject: Re: [xml2rfc] #392 (Version 2 cli): xml2rfc no longer works on Mac, apparently related to SVG processing
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 05 Feb 2019 19:16:19 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--Jkuiifu2aEXSulAd3N2GTUdgJ2vovK4W0
Content-Type: multipart/mixed; boundary="QsFe5AT88jorUkS7WbmUiVSKJQViscrRr";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Carsten Bormann <cabo@tzi.org>
Cc: xml2rfc@ietf.org
Message-ID: <44ce0a27-71c4-9dae-eee6-a06368576198@levkowetz.com>
Subject: Re: [xml2rfc] #392 (Version 2 cli): xml2rfc no longer works on Mac,
 apparently related to SVG processing
References: <060.a75fce1ab1ed90ba9b52074db0d7ce99@tools.ietf.org>
 <71F6014B-6382-482B-A477-0CB97250DD4B@tzi.org>
In-Reply-To: <71F6014B-6382-482B-A477-0CB97250DD4B@tzi.org>

--QsFe5AT88jorUkS7WbmUiVSKJQViscrRr
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable


On 2019-02-05 19:55, Carsten Bormann wrote:
> It doesn=E2=80=99t get to the source file; I can reproduce this with
>=20
> LANG=3D"en_US@calendar=3Diso8601.UTF-8=E2=80=9D xml2rfc foo.bar

Ugh. Ok.

> er, and with
>=20
> LANG=3D=E2=80=9CC=E2=80=9D xml2rfc foo.bar
>=20
> Hmm.  This is getting interesting.
>=20
> Setting LC_ALL to a valid locale (including the above) fixes this.
>=20
> Maybe I don=E2=80=99t understand where the locale comes from if LC_ALL=3D=
=E2=80=9C=E2=80=9D
>=20
> More fun:

Oh, dear.

I still cannot reproduce here, so there's some odd combination of unset
and set enviroment variables at play.  However, as a workaround I'll
add ValueError to the exception catch on line 17 of xml2rfc/writers/pdf.p=
y,
in the next release.


Best regards,

	Henrik


> {{{
> $ locale
> LANG=3D"en_US.UTF-8"
> LC_COLLATE=3D"en_US.UTF-8"
> LC_CTYPE=3D"en_US.UTF-8"
> LC_MESSAGES=3D"en_US.UTF-8"
> LC_MONETARY=3D"en_US.UTF-8"
> LC_NUMERIC=3D"en_US.UTF-8"
> LC_TIME=3D"en_US.UTF-8"
> LC_ALL=3D
> $ xml2rfc foo.bar
> No such file: foo.bar
> $ LANG=3DC xml2rfc foo.bar
> Traceback (most recent call last):
>   File "/Users/cabo/bin/xml2rfc", line 7, in <module>
>     from xml2rfc.run import main
>   File "/Users/cabo/lib/python3.7/site-packages/xml2rfc/__init__.py", l=
ine 14, in <module>
>     from xml2rfc.parser import  XmlRfcError, CachingResolver, XmlRfcPar=
ser, XmlRfc
>   File "/Users/cabo/lib/python3.7/site-packages/xml2rfc/parser.py", lin=
e 17, in <module>
>     from xml2rfc.writers import base
>   File "/Users/cabo/lib/python3.7/site-packages/xml2rfc/writers/__init_=
_.py", line 14, in <module>
>     from xml2rfc.writers.pdf import PdfWriter
>   File "/Users/cabo/lib/python3.7/site-packages/xml2rfc/writers/pdf.py"=
, line 15, in <module>
>     import weasyprint
>   File "/Users/cabo/lib/python3.7/site-packages/weasyprint/__init__.py"=
, line 393, in <module>
>     from .css import preprocess_stylesheet  # noqa
>   File "/Users/cabo/lib/python3.7/site-packages/weasyprint/css/__init__=
=2Epy", line 25, in <module>
>     from . import computed_values
>   File "/Users/cabo/lib/python3.7/site-packages/weasyprint/css/computed=
_values.py", line 21, in <module>
>     from .utils import (
>   File "/Users/cabo/lib/python3.7/site-packages/weasyprint/css/utils.py=
", line 20, in <module>
>     from ..images import LinearGradient, RadialGradient
>   File "/Users/cabo/lib/python3.7/site-packages/weasyprint/images.py", =
line 17, in <module>
>     import cairosvg.parser
>   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/__init__.py", =
line 41, in <module>
>     from . import surface  # noqa
>   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/surface.py", l=
ine 27, in <module>
>     from .defs import (
>   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/defs.py", line=
 24, in <module>
>     from .bounding_box import calculate_bounding_box, is_non_empty_boun=
ding_box
>   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/bounding_box.p=
y", line 26, in <module>
>     from .features import match_features
>   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/features.py", =
line 25, in <module>
>     LOCALE =3D locale.getdefaultlocale()[0] or ''
>   File "/Users/cabo/.homebrew/Cellar/python/3.7.2_1/Frameworks/Python.f=
ramework/Versions/3.7/lib/python3.7/locale.py", line 568, in getdefaultlo=
cale
>     return _parse_localename(localename)
>   File "/Users/cabo/.homebrew/Cellar/python/3.7.2_1/Frameworks/Python.f=
ramework/Versions/3.7/lib/python3.7/locale.py", line 495, in _parse_local=
ename
>     raise ValueError('unknown locale: %s' % localename)
> ValueError: unknown locale: UTF-8
> }}}
>=20
> Unfortunately, the logic in locale.py is pure spaghetti.
> getdefaultlocale seems to pull =E2=80=9CUTF-8" out of envvars that are =
explicitly being overridden.
>=20
> Gr=C3=BC=C3=9Fe, Carsten
>=20
>=20
>=20
>> On Feb 4, 2019, at 21:41, xml2rfc issue tracker <trac@tools.ietf.org> =
wrote:
>>=20
>> #392: xml2rfc no longer works on Mac, apparently related to SVG proces=
sing
>>=20
>> Macs configured for standard weeks tend to have an ugly locale such as=
:
>>=20
>> {{{
>>  LANG=3D"en_US@calendar=3Diso8601.UTF-8"
>> }}}
>>=20
>> (Spare me the words about Apple hiding this necessary, should-be-defau=
lt
>> configuration in the locale.)
>>=20
>> xml2rfc now croaks with
>>=20
>> {{{
>> Traceback (most recent call last):
>>   File "/Users/cabo/bin/xml2rfc", line 7, in <module>
>>     from xml2rfc.run import main
>>   File "/Users/cabo/lib/python3.7/site-packages/xml2rfc/__init__.py", =
line
>> 14, in <module>
>>     from xml2rfc.parser import  XmlRfcError, CachingResolver,
>> XmlRfcParser, XmlRfc
>>   File "/Users/cabo/lib/python3.7/site-packages/xml2rfc/parser.py", li=
ne
>> 17, in <module>
>>     from xml2rfc.writers import base
>>   File "/Users/cabo/lib/python3.7/site-
>> packages/xml2rfc/writers/__init__.py", line 14, in <module>
>>     from xml2rfc.writers.pdf import PdfWriter
>>   File "/Users/cabo/lib/python3.7/site-packages/xml2rfc/writers/pdf.py=
",
>> line 15, in <module>
>>     import weasyprint
>>   File "/Users/cabo/lib/python3.7/site-packages/weasyprint/__init__.py=
",
>> line 393, in <module>
>>     from .css import preprocess_stylesheet  # noqa
>>   File "/Users/cabo/lib/python3.7/site-
>> packages/weasyprint/css/__init__.py", line 25, in <module>
>>     from . import computed_values
>>   File "/Users/cabo/lib/python3.7/site-
>> packages/weasyprint/css/computed_values.py", line 21, in <module>
>>     from .utils import (
>>   File "/Users/cabo/lib/python3.7/site-packages/weasyprint/css/utils.p=
y",
>> line 20, in <module>
>>     from ..images import LinearGradient, RadialGradient
>>   File "/Users/cabo/lib/python3.7/site-packages/weasyprint/images.py",=

>> line 17, in <module>
>>     import cairosvg.parser
>>   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/__init__.py",=

>> line 41, in <module>
>>     from . import surface  # noqa
>>   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/surface.py", =
line
>> 27, in <module>
>>     from .defs import (
>>   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/defs.py", lin=
e
>> 24, in <module>
>>     from .bounding_box import calculate_bounding_box,
>> is_non_empty_bounding_box
>>   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/bounding_box.=
py",
>> line 26, in <module>
>>     from .features import match_features
>>   File "/Users/cabo/lib/python3.7/site-packages/cairosvg/features.py",=

>> line 25, in <module>
>>     LOCALE =3D locale.getdefaultlocale()[0] or ''
>>   File
>> "/Users/cabo/.homebrew/Cellar/python/3.7.2_1/Frameworks/Python.framewo=
rk/Versions/3.7/lib/python3.7/locale.py",
>> line 568, in getdefaultlocale
>>     return _parse_localename(localename)
>>   File
>> "/Users/cabo/.homebrew/Cellar/python/3.7.2_1/Frameworks/Python.framewo=
rk/Versions/3.7/lib/python3.7/locale.py",
>> line 495, in _parse_localename
>>     raise ValueError('unknown locale: %s' % localename)
>> ValueError: unknown locale: UTF-8
>>=20
>> *** xml2rfc failed, status 1 (possibly try with -r)
>> }}}
>>=20
>> --=20
>> ---------------------------+----------------------------------
>> Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
>>     Type:  defect         |     Status:  new
>> Priority:  blocker        |  Milestone:
>> Component:  Version 2 cli  |    Version:  2.10.x
>> Keywords:                 |
>> ---------------------------+----------------------------------
>>=20
>> Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/392=
>
>> xml2rfc <http://tools.ietf.org/tools/xml2rfc/>
>>=20
>>=20
>=20
>=20


--QsFe5AT88jorUkS7WbmUiVSKJQViscrRr--

--Jkuiifu2aEXSulAd3N2GTUdgJ2vovK4W0
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxZ4PgACgkQTptXS4+7
FxpVKhAA1YGny6zJ2ErLdZf+5EBW4796DYLfOKiJq5w1GXUuzeDRWf0Vg+3CV3ez
rwfsMlhOXLBm4YA6KL6Vxanpty4UTUZxvpBOSPK8VMgjwTUHZHNzLqdbxRawm+8o
L8DxMWHRw/t0Dl6su/ArOQGd8TGNwOEGS863ATI33I78Qz1271ejJiVzwent2ZjE
/UDX+uMYSTlrwTnN/ifQNKLgrjSytOefVA0Eu9J982iSg605JlJd4cNLMKUrj9BB
JLdM/m5qH75L1g9twIiA9Io+r1uUgys6i8EnWRdq5acYLW1qdsZKC89k/r+3u9/e
dcADId0YQ3DeOdV+OS4mSYMMedL1HTt/G5ZwyIGh/YxVyewaWGySlEEkmpo/6bb8
Bd9vKhNN82YKNctucQ/swADLvDVkhHN8ut956sW4dU1TIn+RLJxY0IbY8vpnUspw
Z3CtHhygbxvZcyoB0mpV9vCXSQrDItciXc6pwBpNRKSUd1wgG8ZjVCrsU9V/VJ+k
K6sprwMGkg2DpjHBpdqI0glOIzQOEHszGcshwXu97da0MaAFvMUGCIACAG42Sof3
R0Zmc96AS35P4t2658rSqsFxJQmzjg4nqyQygx8Y5/9H2O49OjbYEtB+m1nmJg7U
AFhGgXUKhOcXc5prCjxjd5Mm/3o6sOfJXnZ41J2iiUqTtKDfAvw=
=5fsW
-----END PGP SIGNATURE-----

--Jkuiifu2aEXSulAd3N2GTUdgJ2vovK4W0--


From nobody Tue Feb  5 15:55:15 2019
Return-Path: <chopps@chopps.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 1E779131260 for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 15:55:13 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_NONE=-0.0001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id raI1hQhSbEut for <xml2rfc@ietfa.amsl.com>; Tue,  5 Feb 2019 15:55:11 -0800 (PST)
Received: from smtp.chopps.org (smtp.chopps.org [54.88.81.56]) by ietfa.amsl.com (Postfix) with ESMTP id 7D11C128CF2 for <xml2rfc@ietf.org>; Tue,  5 Feb 2019 15:55:11 -0800 (PST)
Received: from tops.chopps.org (47-50-69-38.static.klmz.mi.charter.com [47.50.69.38]) (using TLSv1.2 with cipher AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by smtp.chopps.org (Postfix) with ESMTPS id 96F5660469; Tue,  5 Feb 2019 18:55:10 -0500 (EST)
References: <sa6lg2uqobf.fsf@chopps.org> <9d1c955f-9d0f-df99-b2bc-9dccacc7875c@levkowetz.com>
User-agent: mu4e 1.1.0; emacs 26.1
From: Christian Hopps <chopps@chopps.org>
To: Henrik Levkowetz <henrik@levkowetz.com>
Cc: Christian Hopps <chopps@chopps.org>, xml2rfc@ietf.org
Date: Tue, 05 Feb 2019 18:54:23 -0500
Message-ID: <sa6ftt1rdu8.fsf@chopps.org>
In-reply-to: <9d1c955f-9d0f-df99-b2bc-9dccacc7875c@levkowetz.com>
MIME-Version: 1.0
Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature"
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/Gbfq6N4faUN5_RVT16KJ9XLfxOM>
Subject: Re: [xml2rfc] <dl>, <dt> and <dd>
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 05 Feb 2019 23:55:13 -0000

--=-=-=
Content-Type: text/plain; format=flowed


Hi Henrik,

Yes the --v3 flag did the trick! For some reason I must have tuned out on the CLI help at the --v2v3 option prior to arriving at the --v3 in the lower formatting section. :)

I've been updating the libslax/oxtradoc util to convert org mode to the newer format. In this case to make use of org mode definition lists:

 - Foo :: A foo is special.
 - Bar :: A bar is better.

I'll try feeding the changes back to Phil when done, or sending a pointer to my repo if that doesn't work.

What I'd really like to do is a direct org mode exporter for emacs directly -- we'll see.

Thanks,
Chris.

Henrik Levkowetz <henrik@levkowetz.com> writes:

> Hi Christian,
>
> On 2019-02-05 15:53, Christian Hopps wrote:
>> I'm having a heck of a time getting a <dl> (definition list)
>> working.
>>
>> I see in the xml2rfc code that it talks about <dl> and hanging lists
>> being deprecated etc, but I cannot get xml2rfc to actual produce any
>> output when I use them. I have to disable DTD validation to even get
>> it to parse.
>>
>> Can someone help me with a short example of using a <dl> that xml2rfc
>> will understand?
>
> I think the issue here is that the legacy parser and formatters don't
> understand the new vocabulary introduced with RFC 7991.  If you wish
> to use that, you should give xml2rfc the --v3 switch, in order to tell
> it to run in v3 mode.
>
> Alternatively, you can indicate that your xml source file uses the
> v3 vocabulary by setting the attribute version="3" on the <rfc> element.
>
> When v3 mode is deemed mature, it will become the default, and the xml2rfc
> version will shift from 2.*.* to 3.*.*.
>
>
> I hope that helps.
>
> Regards,
>
> 	Henrik

--=-=-=
Content-Type: application/pgp-signature; name="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCgAdFiEEm56yH/NF+m1FHa6lLh2DDte4MCUFAlxaIl0ACgkQLh2DDte4
MCXihw/+JqUE9CBZslWaPKGtsPLEYWKkjwItrMEoPbMBP9FCjn5eE4qRoXKiaI8A
4tkXwpTubQMBIH+pIRRX1lS7kOeX6EgO9XLQOR0bDlXs4omTF/R2k2qCy6I9I4px
d2vat2oOHaqsh5U2+7UwqaHqtZ4r6u2z1yIFZNzV4aGifp5khP41LPp2Wsfo2vIa
KjGTwK5cSP3MVYOsmM2zb4QlN+qfEpqqSXyTRco6IgyNdX/wz0ST4KNnOzjKLDcL
nxKtAAB4gKr2lgR1K3yncxCOU4TaN30Nw/8+/1KS8Eo7mmJmv2rh6kdScDUbolhS
yviasSId6almyhY1f058GM/WtOrpNEQsNezvQHYLhqVjcVevuMEnGhtnBLFCKaAz
VT77p17pUlECJEGDYk/nFeKEhsuHUYgTKovSNKWuzc9W+uYMr/CFGaD+Qh+MDW93
x1ocSgjG43jWQFE/M67/KQ+uSnObCw7QS6qNXgahMwjTkTtzm9uxhhG6AWVwV7hN
q7YtzvsPbCO/38WSRpz2X9POsiocEkB9JCXOGwC2OViKmvws1Sb52ZPIi4HrbCde
XqKhd0ayeyCXdRns6vTV/9EQuriWj9U45+fNX8TBmCJgVblxxsEwTxubQ94wTX3G
O9Srt1+iWC4yePFamuWW5XM3Ld9lti91KrzacSPaWzZKKIByKsU=
=f595
-----END PGP SIGNATURE-----
--=-=-=--


From nobody Wed Feb  6 08:47:46 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 82670130E81 for <xml2rfc@ietfa.amsl.com>; Wed,  6 Feb 2019 08:47:44 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id GajVEW7zq-1o for <xml2rfc@ietfa.amsl.com>; Wed,  6 Feb 2019 08:47:42 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 38EAD130EBF for <xml2rfc@ietf.org>; Wed,  6 Feb 2019 08:47:42 -0800 (PST)
Received: from localhost ([::1]:33846 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1grQMM-0006OF-Tl; Wed, 06 Feb 2019 08:47:38 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: julian.reschke@gmx.de, henrik@levkowetz.com
X-Trac-Project: xml2rfc
Date: Wed, 06 Feb 2019 16:47:38 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/390#comment:2
Message-ID: <084.e3169387c20884791af6e8b521850994@tools.ietf.org>
References: <069.45749f014a9a9e539e1cd8580fc19d84@tools.ietf.org>
X-Trac-Ticket-ID: 390
In-Reply-To: <069.45749f014a9a9e539e1cd8580fc19d84@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: julian.reschke@gmx.de, henrik@levkowetz.com, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/xGABPg-aOjyAdIPoXXs_fDnxUeU>
Subject: Re: [xml2rfc] #390 (Version_3_cli_txt): unhelpful diagnostics in v3 mode
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 06 Feb 2019 16:47:45 -0000

#390: unhelpful diagnostics in v3 mode

Description changed by henrik@levkowetz.com:

Old description:

> Parsing file reference-group-test.xml
> Traceback (most recent call last):
>   File "/bin/xml2rfc", line 11, in <module>
>     sys.exit(main())
>   File "/usr/lib/python3.6/site-packages/xml2rfc/run.py", line 548, in
> main
>     writer.write(filename)
>   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
> 245, in write
>     html_tree = self.html_tree()
>   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
> 222, in html_tree
>     html_tree = self.render(None, self.root)
>   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
> 277, in render
>     res = func(h, x)
>   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
> 536, in render_rfc
>     self.render(body, c)
>   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
> 277, in render
>     res = func(h, x)
>   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
> 291, in skip_renderer
>     self.render(h, c)
>   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
> 277, in render
>     res = func(h, x)
>   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
> 2048, in render_section
>     self.render(section, c)
>   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
> 277, in render
>     res = func(h, x)
>   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
> 958, in render_author
>     address.insert(0, lxml.etree.Element('postal'))
> AttributeError: 'NoneType' object has no attribute 'insert'

New description:

 Parsing file reference-group-test.xml
 {{{
 Traceback (most recent call last):
   File "/bin/xml2rfc", line 11, in <module>
     sys.exit(main())
   File "/usr/lib/python3.6/site-packages/xml2rfc/run.py", line 548, in
 main
     writer.write(filename)
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 245, in write
     html_tree = self.html_tree()
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 222, in html_tree
     html_tree = self.render(None, self.root)
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 277, in render
     res = func(h, x)
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 536, in render_rfc
     self.render(body, c)
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 277, in render
     res = func(h, x)
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 291, in skip_renderer
     self.render(h, c)
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 277, in render
     res = func(h, x)
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 2048, in render_section
     self.render(section, c)
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 277, in render
     res = func(h, x)
   File "/usr/lib/python3.6/site-packages/xml2rfc/writers/html.py", line
 958, in render_author
     address.insert(0, lxml.etree.Element('postal'))
 AttributeError: 'NoneType' object has no attribute 'insert'
 }}}

--

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_txt      |    Version:  2.17.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/390#comment:2>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb  6 08:50:15 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 14EF0130E65 for <xml2rfc@ietfa.amsl.com>; Wed,  6 Feb 2019 08:50:14 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id BLXzukqYeHvo for <xml2rfc@ietfa.amsl.com>; Wed,  6 Feb 2019 08:50:12 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 3C31C12F1AC for <xml2rfc@ietf.org>; Wed,  6 Feb 2019 08:50:12 -0800 (PST)
Received: from localhost ([::1]:34073 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1grQOm-0001aE-7m; Wed, 06 Feb 2019 08:50:08 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: julian.reschke@gmx.de, henrik@levkowetz.com
X-Trac-Project: xml2rfc
Date: Wed, 06 Feb 2019 16:50:08 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: /ticket/390#comment:3
Message-ID: <084.a05274a4f5dfe6862499fec1574b46f2@tools.ietf.org>
References: <069.45749f014a9a9e539e1cd8580fc19d84@tools.ietf.org>
X-Trac-Ticket-ID: 390
In-Reply-To: <069.45749f014a9a9e539e1cd8580fc19d84@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: julian.reschke@gmx.de, henrik@levkowetz.com, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/RJZur0nIrupHwzb8bOjDRtoznWI>
Subject: Re: [xml2rfc] #390 (Version_3_cli_txt): unhelpful diagnostics in v3 mode
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 06 Feb 2019 16:50:14 -0000

#390: unhelpful diagnostics in v3 mode

Changes (by henrik@levkowetz.com):

 * status:  new => closed
 * resolution:   => fixed


Comment:

 Fixed in [2976]:

 Fixed an issue with the v3 html renderer when given an author without
 address entry.  Fixes issue #390.

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  closed
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_txt      |    Version:  2.17.*
Resolution:  fixed                  |   Keywords:
------------------------------------+--------------------

Ticket URL: </ticket/390#comment:3>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb  6 13:39:18 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 1129B130EE0; Wed,  6 Feb 2019 13:39:17 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id a8DaTaG1cNW9; Wed,  6 Feb 2019 13:39:15 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id AD8D0130ECD; Wed,  6 Feb 2019 13:39:15 -0800 (PST)
Received: from henrik by durif.tools.ietf.org with local (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1grUuZ-0001Xw-Ix; Wed, 06 Feb 2019 13:39:15 -0800
To: xml2rfc-dev@ietf.org, xml2rfc@ietf.org
Cc: rfc-markdown@ietf.org
Message-Id: <E1grUuZ-0001Xw-Ix@durif.tools.ietf.org>
From: Henrik Levkowetz <henrik@levkowetz.com>
Date: Wed, 06 Feb 2019 13:39:15 -0800
X-SA-Exim-Connect-IP: <locally generated>
X-SA-Exim-Rcpt-To: rfc-markdown@ietf.org, xml2rfc-dev@ietf.org, xml2rfc@ietf.org
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/gSHv3PP58WGkVWKI2AxA2-nhNPI>
Subject: [xml2rfc] New xml2rfc release: v2.18.0
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 06 Feb 2019 21:39:17 -0000

Hi,

This is an automatic notification about a new xml2rfc release, 
v2.18.0, generated when running the mkrelease script.

Release notes:

xml2rfc (2.18.0) ietf; urgency=medium

  This release provides additional support for <referencegroup> rendering, and
  and adds validation of fetched reference files before they are used or put
  in the reference cache.  A warning for un-cited references was added to the
  preptool; this has been present for v2 renderers for a long time, but was
  absent from the v3 specification.  A number of bugs have also been fixed.
  From the commit log:

  * Fixed an issue with the v3 html renderer when given an author without 
    an address entry.  Fixes issue #390.

  * Fixed a bug in the HTML renderer's SVG reading exception code.  Added
    support for a <referencegroup> target attribute, and suppression of target
    URLs for indivudual entries within a <referencegroup>.

  * Adjusted the text rendering of reference annotations to match the html 
    rendering better.  Added support for <referencegroup> target rendering.  
    Suppressed rendering of target URLs for individual entries in a 
    referencegroup.

  * Added a preptool check for reference citations, as earlier provided by v2
    renderers.  Made the reference section numbering code more general, to
    support additional levels in the future.

  * Added an attribute 'target' to <referencegroup>, in order to be able to
    link out to for instance IETF STD and BCP documents.

  * Added ValueError to the exceptions caught on 'import weasyprint' as a 
    workaround for a problem in Python's locale.py file under 3.7.

  * Added the Python version to the version list emitted with --version 
    --verbose.

  * Added validation of included reference files before usage, to prevent
    html files fetched from dns-spoofing captive portals from being used.

 -- Henrik Levkowetz <henrik@levkowetz.com>  06 Feb 2019 13:22:38 -0800

The preferred way to install xml2rfc is by doing 'pip install xml2rfc',
and 'pip install --upgrade xml2rfc' to upgrade.  If there are system-
installed python modules which pip will not upgrade, you may have to
use 'pip install --upgrade --no-deps xml2rfc' and install dependencies
manually.

The new version is also available through SVN checkout, with
  'svn checkout http://svn.tools.ietf.org/svn/tools/xml2rfc/tags/cli/2.18.0'

Regards,

	Henrik
	(via the mkrelease script)


From nobody Thu Feb  7 12:56:43 2019
Return-Path: <julian.reschke@gmx.de>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 560DF129C6A; Thu,  7 Feb 2019 12:56:29 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -2.599
X-Spam-Level: 
X-Spam-Status: No, score=-2.599 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, FREEMAIL_FROM=0.001, RCVD_IN_DNSWL_LOW=-0.7, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id Vqc4E9-Uz5K3; Thu,  7 Feb 2019 12:56:27 -0800 (PST)
Received: from mout.gmx.net (mout.gmx.net [212.227.15.19]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 9D044129A85; Thu,  7 Feb 2019 12:56:26 -0800 (PST)
Received: from [192.168.178.124] ([91.61.58.218]) by mail.gmx.com (mrgmx003 [212.227.17.190]) with ESMTPSA (Nemesis) id 0M243n-1h7zcl3ggF-00u4KC; Thu, 07 Feb 2019 21:56:04 +0100
To: Henrik Levkowetz <henrik@levkowetz.com>, xml2rfc-dev@ietf.org, xml2rfc@ietf.org
Cc: rfc-markdown@ietf.org
References: <E1grUuZ-0001Xw-Ix@durif.tools.ietf.org>
From: Julian Reschke <julian.reschke@gmx.de>
Message-ID: <e7b09ee3-511f-5db1-6273-0c6a40317752@gmx.de>
Date: Thu, 7 Feb 2019 21:56:02 +0100
User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; rv:60.0) Gecko/20100101 Thunderbird/60.5.0
MIME-Version: 1.0
In-Reply-To: <E1grUuZ-0001Xw-Ix@durif.tools.ietf.org>
Content-Type: text/plain; charset=utf-8; format=flowed
Content-Language: en-US
Content-Transfer-Encoding: 7bit
X-Provags-ID: V03:K1:04puHcZ9henYAzgfEYewROd5KztJEd+Z3E72mHTs9DkZ2qcZ7Pj 5WqtMtjDgR90QqCNTXPyYn8TQlPNxC+ZQUCKF2hRbY+7AsEhyLNppWqwAZS5bFsk6us5aCe swGRzApZp+mPIEhBbZlHgd3Txuhrc8pzqLnefW20u7WSm/x71hYaEXk5rVS173O9ACtDhWP RdMczr9GQElxJ4unPityA==
X-UI-Out-Filterresults: notjunk:1;V03:K0:XDUZKd9dv+k=:6NcXpkcq9BrsGvzWWxLaU+ zaaozD4KdKftVuWTwTqNZjTEKG+h+GyLFFos9MZTJuYpmPWWAKM6ubIzcz3eBovnGTxEL0L5g APoCjz6gcfwhPxb0JnGXeutScxk+0EMaAPAKIJainX2QCS0b0TmnSYDJqVrF+OBQIqWFxKKX1 w/Xx/7/QFBKI0ywpNnxELIq3mqBsjNgUetFQ98jKGAl03C08P6BXXlG03v4IRfqhwtmapZHjM zmZE8D9bK22r4X6TfYMHvF51mc51MIuP6HJMWI4I8h5SijZHHhCeF6hCv76B1p8rakNkvTYpo frfCYNNabvR1KwQPI2K74940KK/Q6CKUGG2KsnYWyVP9kgr3Ie+BEQ1Fya9t0iS8oYmqlioNL 0IByiAS/IoF/dupL6UySFoWEMEBx1E8v2gv9mgjJWn0a28i8vz2VaH+o5cjYftT+ndlChxWK1 ZkUU2rQ/7FCr4wlSp9Ad/3FYh6LPq9nrOhc+zUwF67HdgRGqXxNVdsMXqlqwlYS3M6hO0t1hE DSEI1w3/Rz09mhetAh/5IK4h+QMTh4sjges0P89Upne03ACE4lHsVu8pIve35f4FVfO47vYaG m21RD132ywb1dLgV+ToL13BICFUzhdZHk2n5lH/vEjAODfuqGytEn09BcoQXqfudQDKqN53Pd sy4naIaCKXCa11DYiBNXbqCKOfZ56xQBOYgfdlvAGBC89mx0vKs3Ecj2SbCHqrEwLhGp5D6qf xSVgGCrvkQHh18Ixy7c4G6BJAhGnGvIghOuLyYxPwdO7uuIc0E0lAckw2ju0raWlPGaqrZiea vpqK3ljgaBPQvERp9m9aGekV9VRjrIRu42jW1/WF2BJWadDr9+scZumiMMrxYkVPCPtW3246K OnAFs/mZpMnlMuZIPZSSwKKzEcgMVKN1nHwkXmF9UBCj1ua9nEm7dxo1hJHF1yrnsTXmyJNde tLLo8Uf0DBw==
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/KfUitvIpT4zKNMPWosH1JDMIyCQ>
Subject: [xml2rfc] <referencegroup>, was: [xml2rfc-dev] New xml2rfc release: v2.18.0
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Thu, 07 Feb 2019 20:56:30 -0000

On 06.02.2019 22:39, Henrik Levkowetz wrote:
> ...
>    * Adjusted the text rendering of reference annotations to match the html
>      rendering better.  Added support for <referencegroup> target rendering.
>      Suppressed rendering of target URLs for individual entries in a
>      referencegroup.
> ...

With that, I'm getting output such as:

>    [STD69]    Hollenbeck, S., "Extensible Provisioning Protocol (EPP)",
>               STD 69, RFC 5730, DOI 10.17487/RFC5730, August 2009.
> 
>               Hollenbeck, S., "Extensible Provisioning Protocol (EPP)
>               Domain Name Mapping", STD 69, RFC 5731,
>               DOI 10.17487/RFC5731, August 2009.
> 
>               Hollenbeck, S., "Extensible Provisioning Protocol (EPP)
>               Host Mapping", STD 69, RFC 5732, DOI 10.17487/RFC5732,
>               August 2009.
> 
>               Hollenbeck, S., "Extensible Provisioning Protocol (EPP)
>               Contact Mapping", STD 69, RFC 5733, DOI 10.17487/RFC5733,
>               August 2009.
> 
>               Hollenbeck, S., "Extensible Provisioning Protocol (EPP)
>               Transport over TCP", STD 69, RFC 5734,
>               DOI 10.17487/RFC5734, August 2009.

So the links to the RFCs are gone.

This matches slightly more what RFC 7322 says in 
<https://tools.ietf.org/html/rfc7322#section-4.8.6.3>:

>       [STDXXX]  Last name, First initial., Ed. (if applicable),
>                 "RFC Title", Sub-series number, RFC number, Date of
>                 publication.
> 
>                 Last name, First initial., Ed. (if applicable)
>                 and First initial. Last name, Ed. (if applicable),
>                 "RFC Title", Sub-series number, RFC number, Date of
>                 publication.
> 
>                 <http://www.rfc-editor.org/info/std#>

...but it still misses the link to the "aggregate" page.

Now doing this properly (without weird heuristics) requires a vocabulary 
change (see 
<https://github.com/rfc-format/draft-iab-xml2rfc-v3-bis/issues/10>, 
raised over two years ago).

If we are in a hurry, and it seems we are, I would suggest to drop 
<referencegroup> for now instead of doing something that is known to be 
broken. And yes, I'm saying this after spending several hours over the 
previous weekend to get <referencegroup> support into rfc2629.xslt.

Best regards, Julian







From nobody Thu Feb  7 13:06:14 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id E27B1129A85; Thu,  7 Feb 2019 13:06:02 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id qo8Vik7wWucM; Thu,  7 Feb 2019 13:06:01 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 127CE129284; Thu,  7 Feb 2019 13:06:01 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:61070 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1grqrv-0002OU-K2; Thu, 07 Feb 2019 13:06:00 -0800
To: Julian Reschke <julian.reschke@gmx.de>, xml2rfc-dev@ietf.org, xml2rfc@ietf.org
References: <E1grUuZ-0001Xw-Ix@durif.tools.ietf.org> <e7b09ee3-511f-5db1-6273-0c6a40317752@gmx.de>
Cc: rfc-markdown@ietf.org
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <25423be3-515b-87ea-dce0-7aac1f3db976@levkowetz.com>
Date: Thu, 7 Feb 2019 22:05:51 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <e7b09ee3-511f-5db1-6273-0c6a40317752@gmx.de>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="irrd2cNKbq7xKkO8k57Ql0sCIgTsdD8D2"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: rfc-markdown@ietf.org, xml2rfc@ietf.org, xml2rfc-dev@ietf.org, julian.reschke@gmx.de
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/9rYuAfyiAsV0j-QiEogow5ECLto>
Subject: Re: [xml2rfc] <referencegroup>, was: [xml2rfc-dev] New xml2rfc release: v2.18.0
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Thu, 07 Feb 2019 21:06:03 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--irrd2cNKbq7xKkO8k57Ql0sCIgTsdD8D2
Content-Type: multipart/mixed; boundary="DpaXlHDmjqe57xRS3K1e2iAUStqEgAUtd";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Julian Reschke <julian.reschke@gmx.de>, xml2rfc-dev@ietf.org,
 xml2rfc@ietf.org
Cc: rfc-markdown@ietf.org
Message-ID: <25423be3-515b-87ea-dce0-7aac1f3db976@levkowetz.com>
Subject: Re: <referencegroup>, was: [xml2rfc-dev] New xml2rfc release: v2.18.0
References: <E1grUuZ-0001Xw-Ix@durif.tools.ietf.org>
 <e7b09ee3-511f-5db1-6273-0c6a40317752@gmx.de>
In-Reply-To: <e7b09ee3-511f-5db1-6273-0c6a40317752@gmx.de>

--DpaXlHDmjqe57xRS3K1e2iAUStqEgAUtd
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable


On 2019-02-07 21:56, Julian Reschke wrote:
> On 06.02.2019 22:39, Henrik Levkowetz wrote:
>> ...
>>    * Adjusted the text rendering of reference annotations to match the=
 html
>>      rendering better.  Added support for <referencegroup> target rend=
ering.
>>      Suppressed rendering of target URLs for individual entries in a
>>      referencegroup.
>> ...
>=20
> With that, I'm getting output such as:
>=20
>>    [STD69]    Hollenbeck, S., "Extensible Provisioning Protocol (EPP)"=
,
>>               STD 69, RFC 5730, DOI 10.17487/RFC5730, August 2009.
>>=20
>>               Hollenbeck, S., "Extensible Provisioning Protocol (EPP)
>>               Domain Name Mapping", STD 69, RFC 5731,
>>               DOI 10.17487/RFC5731, August 2009.
>>=20
>>               Hollenbeck, S., "Extensible Provisioning Protocol (EPP)
>>               Host Mapping", STD 69, RFC 5732, DOI 10.17487/RFC5732,
>>               August 2009.
>>=20
>>               Hollenbeck, S., "Extensible Provisioning Protocol (EPP)
>>               Contact Mapping", STD 69, RFC 5733, DOI 10.17487/RFC5733=
,
>>               August 2009.
>>=20
>>               Hollenbeck, S., "Extensible Provisioning Protocol (EPP)
>>               Transport over TCP", STD 69, RFC 5734,
>>               DOI 10.17487/RFC5734, August 2009.
>=20
> So the links to the RFCs are gone.
>=20
> This matches slightly more what RFC 7322 says in=20
> <https://tools.ietf.org/html/rfc7322#section-4.8.6.3>:
>=20
>>       [STDXXX]  Last name, First initial., Ed. (if applicable),
>>                 "RFC Title", Sub-series number, RFC number, Date of
>>                 publication.
>>=20
>>                 Last name, First initial., Ed. (if applicable)
>>                 and First initial. Last name, Ed. (if applicable),
>>                 "RFC Title", Sub-series number, RFC number, Date of
>>                 publication.
>>=20
>>                 <http://www.rfc-editor.org/info/std#>
>=20
> ...but it still misses the link to the "aggregate" page.

Did you provide a target attribute in <referencegroup> in order to give i=
t
an aggregate link to render?


	Henrik

> Now doing this properly (without weird heuristics) requires a vocabular=
y=20
> change (see=20
> <https://github.com/rfc-format/draft-iab-xml2rfc-v3-bis/issues/10>,=20
> raised over two years ago).
>=20
> If we are in a hurry, and it seems we are, I would suggest to drop=20
> <referencegroup> for now instead of doing something that is known to be=
=20
> broken. And yes, I'm saying this after spending several hours over the =

> previous weekend to get <referencegroup> support into rfc2629.xslt.
>=20
> Best regards, Julian
>=20
>=20
>=20
>=20
>=20
>=20
>=20


--DpaXlHDmjqe57xRS3K1e2iAUStqEgAUtd--

--irrd2cNKbq7xKkO8k57Ql0sCIgTsdD8D2
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxcna8ACgkQTptXS4+7
FxoJdhAAoSLNHCdVIrCT0e9Qo7o0AX0h49da7Syx1VV4p8e5mvlHFWWwP+0p2AY2
gW0tTRoqqV62k6cQXku/LHQ0kMapVUoJy6Nl20OEdMbe4x0h+P0NdLM/YHHHXv0E
ve2ZZxBM+ASzPxCG2whloZkwle57ibNOAuczeFnQZY2zKlorpXZ7TfDcVSHnZvoV
vGEy4NBEK/6EXFGAaysbRO66TZU2um4/hv3OHzYZ0aDQdmUpMPopcPgmq0+wSpN5
WJmu0hnMGebnC0HHcZXdNSmHWp1BLqOtpAyrXzgoc2aylqiWp6AyIhtMRBv0LFBv
4QeujcuHtxJi7YMEsXz7O0C+7M8tDp0l2ad8mVniHy7slm3D/ls4x9pPQ7uu6JSN
F/Nnp79uP3TgKhxVQN5Vv6uxjn0hQ6t9T5NlCOk/vhJ1MFvYYwFZWzSMU9HBIQJO
CI3LNpHGM/S6EQNNz2+AvuNkR48Os4gOJ0+Kp2YgBxUVKv0zS1wIQis+n+MLMBKg
Bb4vx1VkpZD25777kDf5c/Od2+cM0J0PgAQj9RARWWjPxxxlgXiXPJT8rHbeJCKq
vo9aCHTS9SrjGV6YbJE5xwsEenxnZhEypn8O4SjQnVpvnnVHfUFCt5EFQktYftjl
hyCyjKNBlTQePq7e7pk0MeQgGpFNPmaP1xrtxPUQ0g70daslE1o=
=dWoL
-----END PGP SIGNATURE-----

--irrd2cNKbq7xKkO8k57Ql0sCIgTsdD8D2--


From nobody Thu Feb  7 13:11:37 2019
Return-Path: <julian.reschke@gmx.de>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 10402129A85; Thu,  7 Feb 2019 13:11:31 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -2.6
X-Spam-Level: 
X-Spam-Status: No, score=-2.6 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, FREEMAIL_FROM=0.001, RCVD_IN_DNSWL_LOW=-0.7, RCVD_IN_MSPIKE_H2=-0.001, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id SJppACpe-2tC; Thu,  7 Feb 2019 13:11:29 -0800 (PST)
Received: from mout.gmx.net (mout.gmx.net [212.227.15.15]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id D36F5129284; Thu,  7 Feb 2019 13:11:28 -0800 (PST)
Received: from [192.168.178.124] ([91.61.58.218]) by mail.gmx.com (mrgmx003 [212.227.17.190]) with ESMTPSA (Nemesis) id 0LgqQQ-1hUlza19RG-00oDLH; Thu, 07 Feb 2019 22:11:12 +0100
To: Henrik Levkowetz <henrik@levkowetz.com>, xml2rfc-dev@ietf.org, xml2rfc@ietf.org
Cc: rfc-markdown@ietf.org
References: <E1grUuZ-0001Xw-Ix@durif.tools.ietf.org> <e7b09ee3-511f-5db1-6273-0c6a40317752@gmx.de> <25423be3-515b-87ea-dce0-7aac1f3db976@levkowetz.com>
From: Julian Reschke <julian.reschke@gmx.de>
Message-ID: <26ead582-fcbe-7748-86b4-f1d6e3f401f6@gmx.de>
Date: Thu, 7 Feb 2019 22:11:10 +0100
User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; rv:60.0) Gecko/20100101 Thunderbird/60.5.0
MIME-Version: 1.0
In-Reply-To: <25423be3-515b-87ea-dce0-7aac1f3db976@levkowetz.com>
Content-Type: text/plain; charset=utf-8; format=flowed
Content-Language: en-US
Content-Transfer-Encoding: 7bit
X-Provags-ID: V03:K1:LKDxCzj1ZqHFSYoMDOdolMIqQrRJgvL2SMLo06nYSpKQG5QR23y jlPpu5ess26OGfWPm0VfQiiP6FiY/4i/NrbuhFThgf2yqfk34V3MIcHFyDX/8rUWeMrkqYJ +sOsSPDve+N3FLrQTYfmZllFDnBGsgagJ8T6Glaz70c5jJ+5grJxvPSR7iGreys9wyoEMQx d2rZtLqZ+0nccDC91Aemw==
X-UI-Out-Filterresults: notjunk:1;V03:K0:HHWU/OaH17Q=:oH4KqVn4gqEHyAQmmd4jqS dInpJGvb0AIhplPCO1SMtJ8TNfMSHzchGayU8wZ7eBc8lyLOkSmNQaUFm2BU6wzgwZ7SrInU7 Sf94iZYyI8Ch9SCEh3+HDgOR6EoEEhJ4k6SsVvrhn7IpNXeer/+8ZjsjZxU7R2yxfLeOrZh1A tXm7ogROOaLNpYgsGlTUyjDoPpqf9SADubypNRMMwB+CEAHV7+HrdXNybELErt17Bn0aW0UcG X0rPx/6mUHEWckT3i1HGv9Fybs0yHxcm/n7qfJBA1LJYscnKiykIsllBDsvA7Yif0ePYirqsy opzETnhlL/rjH2As0s2N+lH+PFQRtlQ2sxkWw7Z22JRfDK0lHI57jZKBjKR18YZf4Xt9hVXLq EqqUGoRgLWIdigX6bzEdEFxSrW99ZQxnPnXI0WQzYQwfFDBEV5K+bjBAPxNEc9xbAtEP8Fzw0 oHwLMFb4UEhaDClgUB1qbJKufMskrKWKTg7hlftzBtwg77Z4/kBmU4JSXKIeYebt3/RdSgzZD Zq1c5BgxrIGVOOMoaxvkuJq9Nv0ZqoVSKdf/y5b/qQf1UecU26PSUGPzxhQKFBGVmM6dyWAsy LMUUZ8L0VMlmdjLQbF3KSlZKR6GSkX0xVm8ewi7zsJUEfVV7lJARbpuyO8tPEsUNSAQU/1j3B MaNZXPBd/Nznu37UtAIlUEwwbBx8QCWBDIUtxussdmBcVT+ucr7D/k/Rkv6y0EfEqUhu/JsP4 UBcByapjTmxiW+/RFZMmztTJMpdFS7YOVGtD8ELbIyOl5ETxpax0a031Dfgf/z1xKWW2k8jUu UjJCkuBpcoI6g/qBIv9DgJhNH/Eh/V6taXPpFfHk5f8X5m0177+KoyFaWdYyNSDPO/DPqnhVZ DIEG9nicZ0DVRacIylua7xqIwk0hqEboTkmXThfwwBfD7sVZYR1RRyelLfde/7HEWwR29YK/+ 7uk3ZPUncxQ==
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/1FHaBN-2EeackGy3LhvD6p7xixY>
Subject: Re: [xml2rfc] [Rfc-markdown] <referencegroup>, was: [xml2rfc-dev] New xml2rfc release: v2.18.0
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Thu, 07 Feb 2019 21:11:31 -0000

On 07.02.2019 22:05, Henrik Levkowetz wrote:
> 
> On 2019-02-07 21:56, Julian Reschke wrote:
>> On 06.02.2019 22:39, Henrik Levkowetz wrote:
>>> ...
>>>     * Adjusted the text rendering of reference annotations to match the html
>>>       rendering better.  Added support for <referencegroup> target rendering.
>>>       Suppressed rendering of target URLs for individual entries in a
>>>       referencegroup.
>>> ...
>>
>> With that, I'm getting output such as:
>>
>>>     [STD69]    Hollenbeck, S., "Extensible Provisioning Protocol (EPP)",
>>>                STD 69, RFC 5730, DOI 10.17487/RFC5730, August 2009.
>>>
>>>                Hollenbeck, S., "Extensible Provisioning Protocol (EPP)
>>>                Domain Name Mapping", STD 69, RFC 5731,
>>>                DOI 10.17487/RFC5731, August 2009.
>>>
>>>                Hollenbeck, S., "Extensible Provisioning Protocol (EPP)
>>>                Host Mapping", STD 69, RFC 5732, DOI 10.17487/RFC5732,
>>>                August 2009.
>>>
>>>                Hollenbeck, S., "Extensible Provisioning Protocol (EPP)
>>>                Contact Mapping", STD 69, RFC 5733, DOI 10.17487/RFC5733,
>>>                August 2009.
>>>
>>>                Hollenbeck, S., "Extensible Provisioning Protocol (EPP)
>>>                Transport over TCP", STD 69, RFC 5734,
>>>                DOI 10.17487/RFC5734, August 2009.
>>
>> So the links to the RFCs are gone.
>>
>> This matches slightly more what RFC 7322 says in
>> <https://tools.ietf.org/html/rfc7322#section-4.8.6.3>:
>>
>>>        [STDXXX]  Last name, First initial., Ed. (if applicable),
>>>                  "RFC Title", Sub-series number, RFC number, Date of
>>>                  publication.
>>>
>>>                  Last name, First initial., Ed. (if applicable)
>>>                  and First initial. Last name, Ed. (if applicable),
>>>                  "RFC Title", Sub-series number, RFC number, Date of
>>>                  publication.
>>>
>>>                  <http://www.rfc-editor.org/info/std#>
>>
>> ...but it still misses the link to the "aggregate" page.
> 
> Did you provide a target attribute in <referencegroup> in order to give it
> an aggregate link to render?
> ...

In fact I did not. Thanks for the explanation.

FWIW, xml2rfc (--v3 --text) renders that as "URL: <...>" - why the 
"URL:" prefix?

Best regards, Julian


From nobody Thu Feb  7 13:35:37 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 38122129C6A; Thu,  7 Feb 2019 13:35:26 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id uqKs5tbIvsMt; Thu,  7 Feb 2019 13:35:23 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id AD7E4129A87; Thu,  7 Feb 2019 13:35:23 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:61313 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1grrKM-00068y-1j; Thu, 07 Feb 2019 13:35:22 -0800
To: Julian Reschke <julian.reschke@gmx.de>, xml2rfc-dev@ietf.org, xml2rfc@ietf.org
References: <E1grUuZ-0001Xw-Ix@durif.tools.ietf.org> <e7b09ee3-511f-5db1-6273-0c6a40317752@gmx.de> <25423be3-515b-87ea-dce0-7aac1f3db976@levkowetz.com> <26ead582-fcbe-7748-86b4-f1d6e3f401f6@gmx.de>
Cc: rfc-markdown@ietf.org
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <c92e498c-6a20-ca03-c20f-dab62a11ec1d@levkowetz.com>
Date: Thu, 7 Feb 2019 22:35:14 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <26ead582-fcbe-7748-86b4-f1d6e3f401f6@gmx.de>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="uUm53r2MivEgPQaD3kbbSswQ3n4FMeLS4"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: rfc-markdown@ietf.org, xml2rfc@ietf.org, xml2rfc-dev@ietf.org, julian.reschke@gmx.de
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/hqoFZK90uij8IpkbfdPjdvXhKu0>
Subject: Re: [xml2rfc] [Rfc-markdown] <referencegroup>, was: [xml2rfc-dev] New xml2rfc release: v2.18.0
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Thu, 07 Feb 2019 21:35:26 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--uUm53r2MivEgPQaD3kbbSswQ3n4FMeLS4
Content-Type: multipart/mixed; boundary="gWQivDihfH7C3HwH7oGHHM3ljGQi78E2i";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Julian Reschke <julian.reschke@gmx.de>, xml2rfc-dev@ietf.org,
 xml2rfc@ietf.org
Cc: rfc-markdown@ietf.org
Message-ID: <c92e498c-6a20-ca03-c20f-dab62a11ec1d@levkowetz.com>
Subject: Re: [Rfc-markdown] <referencegroup>, was: [xml2rfc-dev] New xml2rfc
 release: v2.18.0
References: <E1grUuZ-0001Xw-Ix@durif.tools.ietf.org>
 <e7b09ee3-511f-5db1-6273-0c6a40317752@gmx.de>
 <25423be3-515b-87ea-dce0-7aac1f3db976@levkowetz.com>
 <26ead582-fcbe-7748-86b4-f1d6e3f401f6@gmx.de>
In-Reply-To: <26ead582-fcbe-7748-86b4-f1d6e3f401f6@gmx.de>

--gWQivDihfH7C3HwH7oGHHM3ljGQi78E2i
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable



On 2019-02-07 22:11, Julian Reschke wrote:
> On 07.02.2019 22:05, Henrik Levkowetz wrote:
>>=20
>> On 2019-02-07 21:56, Julian Reschke wrote:
>>> On 06.02.2019 22:39, Henrik Levkowetz wrote:
>>>> ...
>>>>     * Adjusted the text rendering of reference annotations to match =
the html
>>>>       rendering better.  Added support for <referencegroup> target r=
endering.
>>>>       Suppressed rendering of target URLs for individual entries in =
a
>>>>       referencegroup.
>>>> ...
>>>
>>> With that, I'm getting output such as:
>>>
>>>>     [STD69]    Hollenbeck, S., "Extensible Provisioning Protocol (EP=
P)",
>>>>                STD 69, RFC 5730, DOI 10.17487/RFC5730, August 2009.
>>>>
>>>>                Hollenbeck, S., "Extensible Provisioning Protocol (EP=
P)
>>>>                Domain Name Mapping", STD 69, RFC 5731,
>>>>                DOI 10.17487/RFC5731, August 2009.
>>>>
>>>>                Hollenbeck, S., "Extensible Provisioning Protocol (EP=
P)
>>>>                Host Mapping", STD 69, RFC 5732, DOI 10.17487/RFC5732=
,
>>>>                August 2009.
>>>>
>>>>                Hollenbeck, S., "Extensible Provisioning Protocol (EP=
P)
>>>>                Contact Mapping", STD 69, RFC 5733, DOI 10.17487/RFC5=
733,
>>>>                August 2009.
>>>>
>>>>                Hollenbeck, S., "Extensible Provisioning Protocol (EP=
P)
>>>>                Transport over TCP", STD 69, RFC 5734,
>>>>                DOI 10.17487/RFC5734, August 2009.
>>>
>>> So the links to the RFCs are gone.
>>>
>>> This matches slightly more what RFC 7322 says in
>>> <https://tools.ietf.org/html/rfc7322#section-4.8.6.3>:
>>>
>>>>        [STDXXX]  Last name, First initial., Ed. (if applicable),
>>>>                  "RFC Title", Sub-series number, RFC number, Date of=

>>>>                  publication.
>>>>
>>>>                  Last name, First initial., Ed. (if applicable)
>>>>                  and First initial. Last name, Ed. (if applicable),
>>>>                  "RFC Title", Sub-series number, RFC number, Date of=

>>>>                  publication.
>>>>
>>>>                  <http://www.rfc-editor.org/info/std#>
>>>
>>> ...but it still misses the link to the "aggregate" page.
>>=20
>> Did you provide a target attribute in <referencegroup> in order to giv=
e it
>> an aggregate link to render?
>> ...
>=20
> In fact I did not. Thanks for the explanation.
>=20
> FWIW, xml2rfc (--v3 --text) renders that as "URL: <...>" - why the=20
> "URL:" prefix?

A tentative implementation.  I tried it both with and without, and in the=

<referencegroup> case it seemed to read better with.  I'm happy to adjust=

based on feedback and consensus.


	Henrik


--gWQivDihfH7C3HwH7oGHHM3ljGQi78E2i--

--uUm53r2MivEgPQaD3kbbSswQ3n4FMeLS4
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxcpJIACgkQTptXS4+7
Fxo6RRAArE0okkjVBnwSe6PAJrYQ+fB8NsN2veTab9n8Jg7YWFgiaCqBgvzH7LhJ
y6CcosGJwoOgm90OtodoxmzIVug+wHQ7qnxdZKOyqXpJ3H85dwTatqtoypLTRhEE
tF/S+aErBywaZ9jSDL8L5rd7vBoxIhY9Sx9iL1eAiYsqcdGu6qoAegMQBf1AhK1G
Et3jkQztKDMzCdCj8TJmVosZyLJ1Pof5HaaXZhvYiYAYC0K8+1rjahb4wXYu81v8
quZdjelH/XYdL8Df3yBk4GfKmXKh0qaJI7wb3BOg+XRnJNw9R/aZMunEQZPBA9qq
oj8ro3FJprANGtxy0Ja67npPNONL94tVGX1/1VmaicX0tBFl+79j8q4RY4bwdOSe
bHvqXffWPICmaXgrcGV26Xoj4gdwPYn6r2/EJQQ3OZAYx39ZtIALVk0Cqslk0xu3
HnJh3pGGJKWsuRFNgaaYVrYXnSDW7YZxlGw50PFU+gDxeF7Jx27VJr4r1Wk39hhm
WcZ+s7USfIMEutv/FThSJSMJ93JgxJUjyFpQQxcwVWiuYj1NY+540HUaKu8x3MKe
0nWPZK0uRrsREZcfQWlB7xYYlo9NDzQDtPZufqKDffbnz7ft1l2DUT88pC+j/cFn
el4zqnzcaDGvZ5x6/DBFqMN8sYWSy12zbld85Eea92mD2giSFA8=
=on4l
-----END PGP SIGNATURE-----

--uUm53r2MivEgPQaD3kbbSswQ3n4FMeLS4--


From nobody Fri Feb  8 14:37:13 2019
Return-Path: <chopps@chopps.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 5E18913101C for <xml2rfc@ietfa.amsl.com>; Fri,  8 Feb 2019 14:37:11 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_NONE=-0.0001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id i9DcNfbsnUS2 for <xml2rfc@ietfa.amsl.com>; Fri,  8 Feb 2019 14:37:10 -0800 (PST)
Received: from smtp.chopps.org (smtp.chopps.org [54.88.81.56]) by ietfa.amsl.com (Postfix) with ESMTP id 3BBC9130E92 for <xml2rfc@ietf.org>; Fri,  8 Feb 2019 14:37:10 -0800 (PST)
Received: from tops.chopps.org (047-050-069-038.biz.spectrum.com [47.50.69.38]) (using TLSv1.2 with cipher AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by smtp.chopps.org (Postfix) with ESMTPS id 8966A60467; Fri,  8 Feb 2019 17:37:09 -0500 (EST)
User-agent: mu4e 1.1.0; emacs 26.1
From: Christian Hopps <chopps@chopps.org>
To: xml2rfc@ietf.org
Cc: chopps@chopps.org
Date: Fri, 08 Feb 2019 17:37:08 -0500
Message-ID: <sa6va1tvre3.fsf@chopps.org>
MIME-Version: 1.0
Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature"
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/wJXIHmrQUXP4l7f476F7Za1Nb4Q>
Subject: [xml2rfc] Pagination missing in v3 format (xml2rfc 2.18.0)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Fri, 08 Feb 2019 22:37:12 -0000

--=-=-=
Content-Type: text/plain; format=flowed


So I switched to V3 xml2rfc format, mostly to get <dl><dt><dd> lists, and I cannot seem to get xml2rfc to produce paginated output. The TOC is missing page numbers, which makes sense b/c there are no page breaks/headers/footers/etc. When I do an HTML output the TOC is missing altogether.

Is there something extra I need to do to get pagination?

Thanks,
Chris.

--=-=-=
Content-Type: application/pgp-signature; name="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCgAdFiEEm56yH/NF+m1FHa6lLh2DDte4MCUFAlxeBJQACgkQLh2DDte4
MCVlzg/+LuoJW6P1jAiHAUnmETLlpcGXgL6T6bOJ+gQ6ZBJb8D7TjfGMnKeP4CDZ
8/CU0h7Qpl6TgcfCXBKfPklBB3kPc/hseGV7ZEt0A48meklTa+SF8usNvROuLtBc
atEyKjckQ4mOGL4isgkP8zibi5FkZplEEwJu0OXBsiyvTqw9T6Meis5uPYCNpOQ7
QDEjHX5obctlFAJJC3V9tjoA+Ziv168F92K+r2XDuE/r3dT60NxOz9w1qFfURnpc
UVAUaEL4Pis2/29G9/aBCyXSponX9pJ1f8EfjvwhMNRC6PZZ/vhoUtMqQ8/2KrJ+
wq+zIqOZL9LI4MU2X5TAXm6sNfXEbTIBrRQpqGqGbQDCF0j+8fav9ZO2C8VlAC32
e2CRg1HyJOfw3FMzX+2tonYbHNx/bAP7RoqFSmt3xJ5jJc5O/3OanxpgA4GPu81N
g5BBSHvD0uM43X0RoPU5nAlICKViEcflziVRvEY/0do9HmypEbmPCIJsqAisfaxN
SmHXIT6ZUd+ohpFjGvAE0BWlrWFaTPry2TyX+Jxwlwao0+1ZLAOhq+M221nXnpQf
CMkIL2HLOStwzqT4FmLcTCC6vuQw/aU6rWT1wCTQc4pITyB2+Y10JJ2plaFtMAsO
s1G0EpeYxY2CMunfUZy3WfqhnnCUXFli64/oU5RTKBg7b+dA3jk=
=SQVu
-----END PGP SIGNATURE-----
--=-=-=--


From nobody Sat Feb  9 00:51:10 2019
Return-Path: <miek@miek.nl>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 0B25A130F34 for <xml2rfc@ietfa.amsl.com>; Sat,  9 Feb 2019 00:51:08 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIMWL_WL_MED=-0.001, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, HTML_MESSAGE=0.001, RCVD_IN_DNSWL_NONE=-0.0001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (2048-bit key) header.d=miek-nl.20150623.gappssmtp.com
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id kDHkDy-xpiUQ for <xml2rfc@ietfa.amsl.com>; Sat,  9 Feb 2019 00:51:06 -0800 (PST)
Received: from mail-yb1-xb2f.google.com (mail-yb1-xb2f.google.com [IPv6:2607:f8b0:4864:20::b2f]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id D6D93130F2F for <xml2rfc@ietf.org>; Sat,  9 Feb 2019 00:51:05 -0800 (PST)
Received: by mail-yb1-xb2f.google.com with SMTP id b15so28205ybn.11 for <xml2rfc@ietf.org>; Sat, 09 Feb 2019 00:51:05 -0800 (PST)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=miek-nl.20150623.gappssmtp.com; s=20150623; h=mime-version:references:in-reply-to:from:date:message-id:subject:to :cc; bh=dws89XP+qT2f2X7mffpbTyUoBk0NOQdMh/cKXkgXixQ=; b=VgKpnymvwP4gSLxUaZW5X04L/M0eDVb7ZlCiqEOntc4PikJAFC0Mf2ewDkMSbes/3B rNx0tzH/G6tKQgo5Tw3bla8U9LCmPa1lBKuo85T71oJUpNSKbl87zD71TIbz65ryEBcS Qs8P2Du0CZReHgUMiAuYV7CCnEk/2CjgttFslXQz1rXLRZ+BJqX7XQWkQj+VFGFpjGyI q19kVNw4MwUKQSMF75wbb+nDfn3OpLZtE/55k50eC0bw8LGd6HYYhv1SFkXFuXcqHteY 75knUznOKoBbTt0zR3/2z5sgSZ+BwhLOdNXx/biCPRKX7CQFhgWVNFm9vffshlqi/uLV EmFw==
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to:cc; bh=dws89XP+qT2f2X7mffpbTyUoBk0NOQdMh/cKXkgXixQ=; b=kX0s6G3XcQ86jsam379Zm1y+kCzW969uhBGgZUL+LLl+Kdu4yzvcegNM14Z1jDSVrh zqOz/rwwILkI3uTGzHwKpgpclNGN+hsuUOB/t3r49hYVuEpfZy1tO1WyuJYUUi0kJ+Bz 1mJWpNHtkRO/3Vii6IY2h9pQG60jMjqmH9jYEldDcQLFD3Tm1gdDuGb4ax82KN7zHipV 8/FQ8qwEyIZdUZBQtyHwvp6Qq0CKVpHEsNDG/eph1j5xSatcONDaxqr47TKNjZh94G3k Btax0zdSmlkqh9xE9zG2rsRg5tM0LvoV5KtaqspZLgKaJ7j3WrDzuPXsimqwYuhT4tq1 FCPw==
X-Gm-Message-State: AHQUAuafq0wXUASnbG3989CJ+FzsMnwhk2l3Li+6umo4AA3J8rI8VUir A3oaMC4La/b1yBr79+YgZFWGZ5hO5EUUYoq97dSIpw==
X-Google-Smtp-Source: AHgI3IYrw2+Ou3sQ3aEloSq1Tb6JB9P8bIZphjcGQ4VfipuNTCdAvvPcE/WcJ2Mpo6dfmnmByGLtiyuPgHYWukkxP6s=
X-Received: by 2002:a25:e056:: with SMTP id x83mr8996204ybg.301.1549702264717;  Sat, 09 Feb 2019 00:51:04 -0800 (PST)
MIME-Version: 1.0
References: <sa6va1tvre3.fsf@chopps.org>
In-Reply-To: <sa6va1tvre3.fsf@chopps.org>
From: Miek Gieben <miek@miek.nl>
Date: Sat, 9 Feb 2019 08:50:52 +0000
Message-ID: <CAJrXxAPX8u1GyXq9EqzVA3WRC_HD8uxFOO6Tn3f1+2QJrZexqg@mail.gmail.com>
To: Christian Hopps <chopps@chopps.org>
Cc: XML2RFC Interest Group <xml2rfc@ietf.org>
Content-Type: multipart/alternative; boundary="000000000000ff1ca40581722ccd"
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/WiHLpl59HqKRMlEDtFlHzl5fWmg>
Subject: Re: [xml2rfc] Pagination missing in v3 format (xml2rfc 2.18.0)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Sat, 09 Feb 2019 08:51:08 -0000

--000000000000ff1ca40581722ccd
Content-Type: text/plain; charset="UTF-8"

This is by design. In the text output there are no pages, just a long
stretch of text.

On Fri, 8 Feb 2019, 22:37 Christian Hopps <chopps@chopps.org wrote:

>
> So I switched to V3 xml2rfc format, mostly to get <dl><dt><dd> lists, and
> I cannot seem to get xml2rfc to produce paginated output. The TOC is
> missing page numbers, which makes sense b/c there are no page
> breaks/headers/footers/etc. When I do an HTML output the TOC is missing
> altogether.
>
> Is there something extra I need to do to get pagination?
>
> Thanks,
> Chris.
> _______________________________________________
> xml2rfc mailing list
> xml2rfc@ietf.org
> https://www.ietf.org/mailman/listinfo/xml2rfc
>

--000000000000ff1ca40581722ccd
Content-Type: text/html; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

<div dir=3D"auto">This is by design. In the text output there are no pages,=
 just a long stretch of text.</div><br><div class=3D"gmail_quote"><div dir=
=3D"ltr">On Fri, 8 Feb 2019, 22:37 Christian Hopps &lt;<a href=3D"mailto:ch=
opps@chopps.org">chopps@chopps.org</a> wrote:<br></div><blockquote class=3D=
"gmail_quote" style=3D"margin:0 0 0 .8ex;border-left:1px #ccc solid;padding=
-left:1ex"><br>
So I switched to V3 xml2rfc format, mostly to get &lt;dl&gt;&lt;dt&gt;&lt;d=
d&gt; lists, and I cannot seem to get xml2rfc to produce paginated output. =
The TOC is missing page numbers, which makes sense b/c there are no page br=
eaks/headers/footers/etc. When I do an HTML output the TOC is missing altog=
ether.<br>
<br>
Is there something extra I need to do to get pagination?<br>
<br>
Thanks,<br>
Chris.<br>
_______________________________________________<br>
xml2rfc mailing list<br>
<a href=3D"mailto:xml2rfc@ietf.org" target=3D"_blank" rel=3D"noreferrer">xm=
l2rfc@ietf.org</a><br>
<a href=3D"https://www.ietf.org/mailman/listinfo/xml2rfc" rel=3D"noreferrer=
 noreferrer" target=3D"_blank">https://www.ietf.org/mailman/listinfo/xml2rf=
c</a><br>
</blockquote></div>

--000000000000ff1ca40581722ccd--


From nobody Sat Feb  9 01:21:02 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 543B91311A6 for <xml2rfc@ietfa.amsl.com>; Sat,  9 Feb 2019 01:21:00 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id pLxv1tpw6Gkb for <xml2rfc@ietfa.amsl.com>; Sat,  9 Feb 2019 01:20:58 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id B5C201286D8 for <xml2rfc@ietf.org>; Sat,  9 Feb 2019 01:20:58 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:58560 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gsOoj-0006rl-LZ; Sat, 09 Feb 2019 01:20:58 -0800
To: Miek Gieben <miek@miek.nl>, Christian Hopps <chopps@chopps.org>
References: <sa6va1tvre3.fsf@chopps.org> <CAJrXxAPX8u1GyXq9EqzVA3WRC_HD8uxFOO6Tn3f1+2QJrZexqg@mail.gmail.com>
Cc: XML2RFC Interest Group <xml2rfc@ietf.org>
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <2a44e1ac-c833-f80c-959c-de5ce6bf1c0a@levkowetz.com>
Date: Sat, 9 Feb 2019 10:20:14 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <CAJrXxAPX8u1GyXq9EqzVA3WRC_HD8uxFOO6Tn3f1+2QJrZexqg@mail.gmail.com>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="2WBIvF78WfdDomluHGMImajR8V0tcITxw"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, chopps@chopps.org, miek@miek.nl
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/auCTs2eLxoL0O3qgLGXZ5yyLbVI>
Subject: Re: [xml2rfc] Pagination missing in v3 format (xml2rfc 2.18.0)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Sat, 09 Feb 2019 09:21:00 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--2WBIvF78WfdDomluHGMImajR8V0tcITxw
Content-Type: multipart/mixed; boundary="3JpICd2tQeJnh0bQViqms4lh6eHQlOFM2";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Miek Gieben <miek@miek.nl>, Christian Hopps <chopps@chopps.org>
Cc: XML2RFC Interest Group <xml2rfc@ietf.org>
Message-ID: <2a44e1ac-c833-f80c-959c-de5ce6bf1c0a@levkowetz.com>
Subject: Re: [xml2rfc] Pagination missing in v3 format (xml2rfc 2.18.0)
References: <sa6va1tvre3.fsf@chopps.org>
 <CAJrXxAPX8u1GyXq9EqzVA3WRC_HD8uxFOO6Tn3f1+2QJrZexqg@mail.gmail.com>
In-Reply-To: <CAJrXxAPX8u1GyXq9EqzVA3WRC_HD8uxFOO6Tn3f1+2QJrZexqg@mail.gmail.com>

--3JpICd2tQeJnh0bQViqms4lh6eHQlOFM2
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable


Yes, I got the impression that the v3 design team wanted it that way.  Bu=
t
it seems that the IESG may want pagination for draft submissions, so we
could still be getting an option to do pagination.

	Henrik

On 2019-02-09 09:50, Miek Gieben wrote:
> This is by design. In the text output there are no pages, just a long
> stretch of text.
>=20
> On Fri, 8 Feb 2019, 22:37 Christian Hopps <chopps@chopps.org wrote:
>=20
>>
>> So I switched to V3 xml2rfc format, mostly to get <dl><dt><dd> lists, =
and
>> I cannot seem to get xml2rfc to produce paginated output. The TOC is
>> missing page numbers, which makes sense b/c there are no page
>> breaks/headers/footers/etc. When I do an HTML output the TOC is missin=
g
>> altogether.
>>
>> Is there something extra I need to do to get pagination?
>>
>> Thanks,
>> Chris.
>> _______________________________________________
>> xml2rfc mailing list
>> xml2rfc@ietf.org
>> https://www.ietf.org/mailman/listinfo/xml2rfc
>>
>=20
>=20
>=20
> _______________________________________________
> xml2rfc mailing list
> xml2rfc@ietf.org
> https://www.ietf.org/mailman/listinfo/xml2rfc
>=20


--3JpICd2tQeJnh0bQViqms4lh6eHQlOFM2--

--2WBIvF78WfdDomluHGMImajR8V0tcITxw
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxem08ACgkQTptXS4+7
FxrF5g/8D+5W1IfYD8BwbzQLjWEjq8N7Fe1arQjFWQ1DWLx2rRN/Lz2rSVkv4YW/
GMm97G5y9ARRfXfgugOhkgH0JMEntLo9G9CTFz4rBYjMPB1EH/z7nR0iTNpDr4j5
/CWk/LkLAUVHe0ifdyEkxXheyVh5LFJHn9waEOa5d54qKqxvCBC+xQCTRfqhCnN6
LH0/I4w3Bchm8GWExlygto6O2YtpxVFHDipXk/CLtl6JRelirGIxDcja3UZGe1Pd
YpPJsX1ibXukAyuPR9FIFw9Z0IR/GItTVEqO+8yvrS5WhhvH1eLqWSReWTlN8kZQ
nhwlBS+rPTwSxFE77jF/iqBthvmAKEtjrlksCntpYm9ZqDHcsXA2laZHedzgwxBk
uTvIQqeVgH3hElzlO2Blzn81SoyN4foRbw6KbZIJ2M6S+iRpFrtLzOA49uJU8XoM
QgvSoaW3H6jS1sDpoaGLb7MWc0DLNvTLAfxmUs9+dFMqz47ID4P+3h9moCeiz6Ac
7D4SGFaoQgbvmwyrGUT5ufxAlL8ITEx/VGSFju8ZDKMCNLbPH/iX0SmzPCCWN9vC
eaBd6q39c1f8ugXyuqxxrUWGqBi+qWbEBdZ+CnEMSsLrFKeapcWuPQ2SjTPVQqWj
WXayAzMt3ZGpdBOaVW2wqCbFLjoI5zvq9LFGq57YiLiEB2jX6Pw=
=v1Qo
-----END PGP SIGNATURE-----

--2WBIvF78WfdDomluHGMImajR8V0tcITxw--


From nobody Sat Feb  9 03:42:09 2019
Return-Path: <chopps@chopps.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 52DA112D829 for <xml2rfc@ietfa.amsl.com>; Sat,  9 Feb 2019 03:42:07 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_NONE=-0.0001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id IhQDc9Ud7Jc4 for <xml2rfc@ietfa.amsl.com>; Sat,  9 Feb 2019 03:42:05 -0800 (PST)
Received: from smtp.chopps.org (smtp.chopps.org [54.88.81.56]) by ietfa.amsl.com (Postfix) with ESMTP id 70685126F72 for <xml2rfc@ietf.org>; Sat,  9 Feb 2019 03:42:05 -0800 (PST)
Received: from tops.chopps.org (047-050-069-038.biz.spectrum.com [47.50.69.38]) (using TLSv1.2 with cipher AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by smtp.chopps.org (Postfix) with ESMTPS id 06A9360467; Sat,  9 Feb 2019 06:42:03 -0500 (EST)
References: <sa6va1tvre3.fsf@chopps.org> <CAJrXxAPX8u1GyXq9EqzVA3WRC_HD8uxFOO6Tn3f1+2QJrZexqg@mail.gmail.com> <2a44e1ac-c833-f80c-959c-de5ce6bf1c0a@levkowetz.com>
User-agent: mu4e 1.1.0; emacs 26.1
From: Christian Hopps <chopps@chopps.org>
To: Henrik Levkowetz <henrik@levkowetz.com>
Cc: Miek Gieben <miek@miek.nl>, Christian Hopps <chopps@chopps.org>, XML2RFC Interest Group <xml2rfc@ietf.org>
In-reply-to: <2a44e1ac-c833-f80c-959c-de5ce6bf1c0a@levkowetz.com>
Date: Sat, 09 Feb 2019 06:42:03 -0500
Message-ID: <sa6o97l9oj8.fsf@chopps.org>
MIME-Version: 1.0
Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature"
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/-gA6A3bnz_4XSwMGAP1UFlVrQds>
Subject: Re: [xml2rfc] Pagination missing in v3 format (xml2rfc 2.18.0)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Sat, 09 Feb 2019 11:42:08 -0000

--=-=-=
Content-Type: text/plain; format=flowed


Huh, how about that.

I also discovered the that HTML TOC was sitting there on the right side of my browser window as well and I simply missed it, which may sound dumb, but let me try and reason why.

I use a large monitor and a single browser window (normally) so the text is sort of centered in the window with lots of white space on the left and right, then the TOC is on the far right side. This far right side is where Ads normally go, and I guess my brain has literally been trained now to ignore almost any content on the far right.

Has putting the TOC on the left side been considered? I sort of like having it separate and easily clickable anytime, but I fear I won't be the only one experiencing right-side filtering.

Thanks,
Chris.

Henrik Levkowetz <henrik@levkowetz.com> writes:

> Yes, I got the impression that the v3 design team wanted it that way.  But
> it seems that the IESG may want pagination for draft submissions, so we
> could still be getting an option to do pagination.
>
> 	Henrik
>
> On 2019-02-09 09:50, Miek Gieben wrote:
>> This is by design. In the text output there are no pages, just a long
>> stretch of text.
>>
>> On Fri, 8 Feb 2019, 22:37 Christian Hopps <chopps@chopps.org wrote:
>>
>>>
>>> So I switched to V3 xml2rfc format, mostly to get <dl><dt><dd> lists, and
>>> I cannot seem to get xml2rfc to produce paginated output. The TOC is
>>> missing page numbers, which makes sense b/c there are no page
>>> breaks/headers/footers/etc. When I do an HTML output the TOC is missing
>>> altogether.
>>>
>>> Is there something extra I need to do to get pagination?
>>>
>>> Thanks,
>>> Chris.
>>> _______________________________________________
>>> xml2rfc mailing list
>>> xml2rfc@ietf.org
>>> https://www.ietf.org/mailman/listinfo/xml2rfc
>>>
>>
>>
>>
>> _______________________________________________
>> xml2rfc mailing list
>> xml2rfc@ietf.org
>> https://www.ietf.org/mailman/listinfo/xml2rfc
>>


--=-=-=
Content-Type: application/pgp-signature; name="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCgAdFiEEm56yH/NF+m1FHa6lLh2DDte4MCUFAlxevIsACgkQLh2DDte4
MCVtkQ//RVvj+qmmq8f9ezIfqAR3fATNlT2ThAS5Lt0sDNFFGxdEUEp6cTQRuYX+
UQbv9DEyFcYJq74gM9sZ6Q7vjg8szKTN7dNJ+pGvzj2gDhzJIvRoa98EB0VIs6Pa
65QSjCQ/S8YJrcM2zJePC+Si8V1yndQ/FXrPtlFzvAK0cZ7sUd3G6mgpnau12Elg
MCrkWpvoksicDjPv7ps6El9CRdhah+vegupUkrGIveHi6zwrU0ZpPetRB7aYLOOk
fgNQVcJaQMfTpbRsvajR/4Z2fImuP/9AWHgWesqZGPb2FzYs1J1DfS1Tq3ZTEKzQ
P1v3K1qO6nrye/mPGMygI3NhORCh953NdcYf7u3oZ5G4XV/DsyyjnGmK3FluSSqh
/WMtrHzNwr9zUF+F9fwEqBFT1mo2DovtC4PygKaQMXs7xjafbtFl0BcoaJ4iXmoK
YS1W/M0gtsLLroLwmseKNChsDLXsVOyytIfB2UB2jpzUeFADAd4Cq97P9vaQ4Q39
fRbxweyjBOmn0plLsPWjRrm74RVWCZj4z4Gg2vGimImfgvr3vFdBmvo9YZPWPbey
VLqm08WpEuxSoCVnJZ8jAyMnUa+qOWqAYJea4C7GchQco48fOp4GHaCdYZRQV+0k
4d4Pt/j6aHqxiQGxX0hKR7wcPynmqdMIwRwWhlEJXZtaKUk9aWc=
=w/3h
-----END PGP SIGNATURE-----
--=-=-=--


From nobody Sat Feb  9 04:04:48 2019
Return-Path: <chopps@chopps.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 3AA9B128D52 for <xml2rfc@ietfa.amsl.com>; Sat,  9 Feb 2019 04:04:46 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_NONE=-0.0001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id yhP3KYBThcet for <xml2rfc@ietfa.amsl.com>; Sat,  9 Feb 2019 04:04:44 -0800 (PST)
Received: from smtp.chopps.org (smtp.chopps.org [54.88.81.56]) by ietfa.amsl.com (Postfix) with ESMTP id B13FE128CF2 for <xml2rfc@ietf.org>; Sat,  9 Feb 2019 04:04:44 -0800 (PST)
Received: from tops.chopps.org (047-050-069-038.biz.spectrum.com [47.50.69.38]) (using TLSv1.2 with cipher AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by smtp.chopps.org (Postfix) with ESMTPS id EA4B260467; Sat,  9 Feb 2019 07:04:43 -0500 (EST)
User-agent: mu4e 1.1.0; emacs 26.1
From: Christian Hopps <chopps@chopps.org>
To: XML2RFC Interest Group <xml2rfc@ietf.org>
Cc: chopps@chopps.org
Date: Sat, 09 Feb 2019 07:04:43 -0500
Message-ID: <sa6mun59nhg.fsf@chopps.org>
MIME-Version: 1.0
Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature"
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/dfcXLeSd4yvAxt7kmz7mMPLr7oM>
Subject: [xml2rfc] bad country warning.
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Sat, 09 Feb 2019 12:04:46 -0000

--=-=-=
Content-Type: text/plain; format=flowed

Hi,

So I get the following warning from xml2rfc:

    (No source line available): Warning: Did not find a recognized country entry for author Christian Hopps

I think this warning should be only be enabled if an actual author postal address is being given (and country is missing from it). In my case I am not specifying a postal address. RFC7332 agrees:

    Contact information must include a long-lived email address and
    optionally may include a postal address and/or telephone number. If
    the postal address is included, it should include the country name,
    using the English short name listed by the ISO 3166 Maintenance
    Agency [ISO_OBP].

Thanks,
Chris.

--=-=-=
Content-Type: application/pgp-signature; name="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCgAdFiEEm56yH/NF+m1FHa6lLh2DDte4MCUFAlxewdsACgkQLh2DDte4
MCWXbhAAk0MCjzrY4dmDGD8qaCJD5BFCyqGdvrESySDSZLpsER6j4Ayb/rVsY8dC
OqeXrxNgHLBoWcQZPq77B20iMES+dJUDplihjiFioKMYzpFHlPtlrinZmJHb52JF
+icqr2SIPxrEbO4PO/qDMCsa6VwItNUH0AqdvcggQLRZSbXBE8kU24DT82JgEBG/
My2udnmRqDAa83N1MzQTqN3GNwXa0oKOokfXthCd3jsdjkvZQdBim+8fEU17IrcX
mlC5HaUMax26b+M5447hWqKmxTUbR6If27kSJOU1p6DN9RM46/eOZ71CLO63Sx5e
m6CjInJ60r2ITjeJzxrHW5iNfdQIvdIKbR2NBnUL28CnQpQz3l1AmJscERAUoCmM
mecdCB/uhV/mI0zeL5SSP2M3qoRBvtf2tQ8lUYWemJAdtfsaYfuiBXpNC9Z+ancd
solJVhjJ41nwpQDH+qnXWpo+x95CfvUlfojO3SdFWYihDChMa7mh87FrxA6WzBOL
q8EJ+1Hh+IvtE6TK5o+d8IfKfzSRIfhTkkrvhsLU+pbYp+xJhZlY02AFnTHXTQoh
ZSstcw1XTkCi43J9EhG9jTUGEv2M8+MDhXGiUW1bOLZ6FAxMgDY0HK/4hpVb9ltz
mdkpSRYeGr9plmJSXoqwAhTFNzvhabIMpGNibX5M7lhiDr8/exk=
=CVGz
-----END PGP SIGNATURE-----
--=-=-=--


From nobody Sat Feb  9 04:45:11 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 74FD512D829 for <xml2rfc@ietfa.amsl.com>; Sat,  9 Feb 2019 04:45:09 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id XAPqmLuzICif for <xml2rfc@ietfa.amsl.com>; Sat,  9 Feb 2019 04:45:07 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 91E7F1311AF for <xml2rfc@ietf.org>; Sat,  9 Feb 2019 04:45:07 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:59899 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gsS0H-0001B6-Tq; Sat, 09 Feb 2019 04:45:06 -0800
To: Christian Hopps <chopps@chopps.org>, XML2RFC Interest Group <xml2rfc@ietf.org>
References: <sa6mun59nhg.fsf@chopps.org>
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <23f4b2aa-61c3-1b0d-1000-41bfb747fced@levkowetz.com>
Date: Sat, 9 Feb 2019 13:44:58 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <sa6mun59nhg.fsf@chopps.org>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="FLHBS5MkGGQEBnHNFSQaJv0MrK3R6WCgP"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, chopps@chopps.org
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/h9BaVosG8rG5O__OBqmpEWHLlCw>
Subject: Re: [xml2rfc] bad country warning.
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Sat, 09 Feb 2019 12:45:10 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--FLHBS5MkGGQEBnHNFSQaJv0MrK3R6WCgP
Content-Type: multipart/mixed; boundary="0KPOuFUquJCMVKf8HO5HNw1jluO6IqatO";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Christian Hopps <chopps@chopps.org>,
 XML2RFC Interest Group <xml2rfc@ietf.org>
Message-ID: <23f4b2aa-61c3-1b0d-1000-41bfb747fced@levkowetz.com>
Subject: Re: [xml2rfc] bad country warning.
References: <sa6mun59nhg.fsf@chopps.org>
In-Reply-To: <sa6mun59nhg.fsf@chopps.org>

--0KPOuFUquJCMVKf8HO5HNw1jluO6IqatO
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable

Hi Chris,

On 2019-02-09 13:04, Christian Hopps wrote:
> Hi,
>=20
> So I get the following warning from xml2rfc:
>=20
>     (No source line available): Warning: Did not find a recognized coun=
try entry for author Christian Hopps
>=20
> I think this warning should be only be enabled if an actual author
> postal address is being given (and country is missing from it). In my
> case I am not specifying a postal address. RFC7332 agrees:
>=20
>     Contact information must include a long-lived email address and
>     optionally may include a postal address and/or telephone number. If=

>     the postal address is included, it should include the country name,=

>     using the English short name listed by the ISO 3166 Maintenance
>     Agency [ISO_OBP].

Makes sense.  I'll make it so in the next release.


Rgds,

	Henrik


--0KPOuFUquJCMVKf8HO5HNw1jluO6IqatO--

--FLHBS5MkGGQEBnHNFSQaJv0MrK3R6WCgP
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxey0oACgkQTptXS4+7
FxqOOhAAkvVKENpJ43Uc0t9ERCM53YONVZJQCcWwlsJfQGAhJ+YCTUqI1amqmGmi
jO665O3Wcu61fhGSOvrb1AQ+DyIR7P1/N9ArRpTcAxGt7GpRvd2As2Wy1hb5qevY
ydw2LZcYshyg7T8bN2m5n50UfnnVd21QixopaVauM27hSN2vbcF/4OsOBAgJCxn5
Kt2EJHNnVWZYpNxbsm53legu7MS+TGQXYpkj0huGnylln9nyNXInfKOczssNlVoR
3QWiyeBRi7Y5q9JoBnBGkQJrwtTIsAxEyNGYeN2r5LfP24UHaLPlcQhz2iZdWOd0
lkwgGdqH5Jq79xeI8aguwIoP/kQSIaMqoOU2N4gm2Ei3Jv6q59zp0ecS/mtbcz9j
0LV8Hnf2AoGynsuXtT36ojw+Zx0K3LJBL2pvHu5byP24duZtmaE4wNumnqu6EGsH
YoLkKePTzANv0DXf3ZkVBr8DrHdn1rBepUV5aFs7x0ekoXpbq/b/2UKKJYKbH6YN
emTYv3RyjPi2NJwSBS4QmoSrT1IUfCqFVk26ihVSaQYFG1zHz/YVKRPFeiBeQhso
EJa+YcfuHczbYaC3Ar+A+cQUyVCiQKbXxyNiaiyzs8iYa0iBNPNioYE4YIlS5Nh3
mBTrvR+cPXeJtZdGrtq7WLbz4k5pcjFuz8bMbda1r95cmqqKBlY=
=2R15
-----END PGP SIGNATURE-----

--FLHBS5MkGGQEBnHNFSQaJv0MrK3R6WCgP--


From nobody Sat Feb  9 04:49:28 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 33DF812D829 for <xml2rfc@ietfa.amsl.com>; Sat,  9 Feb 2019 04:49:27 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id Yrw7alxSlQPs for <xml2rfc@ietfa.amsl.com>; Sat,  9 Feb 2019 04:49:25 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id E26D112D4E7 for <xml2rfc@ietf.org>; Sat,  9 Feb 2019 04:49:24 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:59929 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gsS4Q-00075R-HR; Sat, 09 Feb 2019 04:49:23 -0800
To: Christian Hopps <chopps@chopps.org>
References: <sa6va1tvre3.fsf@chopps.org> <CAJrXxAPX8u1GyXq9EqzVA3WRC_HD8uxFOO6Tn3f1+2QJrZexqg@mail.gmail.com> <2a44e1ac-c833-f80c-959c-de5ce6bf1c0a@levkowetz.com> <sa6o97l9oj8.fsf@chopps.org>
Cc: Miek Gieben <miek@miek.nl>, XML2RFC Interest Group <xml2rfc@ietf.org>
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <33350337-f5ae-89d7-329f-b136e1ee59f6@levkowetz.com>
Date: Sat, 9 Feb 2019 13:49:15 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <sa6o97l9oj8.fsf@chopps.org>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="a8N23vJoSH319wrEXjRBCANQlgtjmljJB"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, miek@miek.nl, chopps@chopps.org
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/Q3HKj0oELQZdWeTD-Lg0wEVjTbE>
Subject: Re: [xml2rfc] Pagination missing in v3 format (xml2rfc 2.18.0)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Sat, 09 Feb 2019 12:49:27 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--a8N23vJoSH319wrEXjRBCANQlgtjmljJB
Content-Type: multipart/mixed; boundary="JxwNNp04XVRI126pgGunABqxbCPLBnCgJ";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Christian Hopps <chopps@chopps.org>
Cc: Miek Gieben <miek@miek.nl>, XML2RFC Interest Group <xml2rfc@ietf.org>
Message-ID: <33350337-f5ae-89d7-329f-b136e1ee59f6@levkowetz.com>
Subject: Re: [xml2rfc] Pagination missing in v3 format (xml2rfc 2.18.0)
References: <sa6va1tvre3.fsf@chopps.org>
 <CAJrXxAPX8u1GyXq9EqzVA3WRC_HD8uxFOO6Tn3f1+2QJrZexqg@mail.gmail.com>
 <2a44e1ac-c833-f80c-959c-de5ce6bf1c0a@levkowetz.com>
 <sa6o97l9oj8.fsf@chopps.org>
In-Reply-To: <sa6o97l9oj8.fsf@chopps.org>

--JxwNNp04XVRI126pgGunABqxbCPLBnCgJ
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable

Hi Chris,

On 2019-02-09 12:42, Christian Hopps wrote:
>=20
> Huh, how about that.
>=20
> I also discovered the that HTML TOC was sitting there on the right
> side of my browser window as well and I simply missed it, which may
> sound dumb, but let me try and reason why.
>=20
> I use a large monitor and a single browser window (normally) so the
> text is sort of centered in the window with lots of white space on
> the left and right, then the TOC is on the far right side. This far
> right side is where Ads normally go, and I guess my brain has
> literally been trained now to ignore almost any content on the far
> right.
>=20
> Has putting the TOC on the left side been considered?

I don't know; the creator of the basic CSS will have to answer that.

> I sort of like
> having it separate and easily clickable anytime, but I fear I won't
> be the only one experiencing right-side filtering.

Hmm.  The body text has a width limitation, but I see that in a very
wide window the ToC migrates right, away from the body.  That seems
like a bug.  My first adjustment would be to make it stick next to the
body when the body has reached max width.

	Henrik

>=20
> Thanks,
> Chris.
>=20
> Henrik Levkowetz <henrik@levkowetz.com> writes:
>=20
>> Yes, I got the impression that the v3 design team wanted it that way. =
 But
>> it seems that the IESG may want pagination for draft submissions, so w=
e
>> could still be getting an option to do pagination.
>>
>> 	Henrik
>>
>> On 2019-02-09 09:50, Miek Gieben wrote:
>>> This is by design. In the text output there are no pages, just a long=

>>> stretch of text.
>>>
>>> On Fri, 8 Feb 2019, 22:37 Christian Hopps <chopps@chopps.org wrote:
>>>
>>>>
>>>> So I switched to V3 xml2rfc format, mostly to get <dl><dt><dd> lists=
, and
>>>> I cannot seem to get xml2rfc to produce paginated output. The TOC is=

>>>> missing page numbers, which makes sense b/c there are no page
>>>> breaks/headers/footers/etc. When I do an HTML output the TOC is miss=
ing
>>>> altogether.
>>>>
>>>> Is there something extra I need to do to get pagination?
>>>>
>>>> Thanks,
>>>> Chris.
>>>> _______________________________________________
>>>> xml2rfc mailing list
>>>> xml2rfc@ietf.org
>>>> https://www.ietf.org/mailman/listinfo/xml2rfc
>>>>
>>>
>>>
>>>
>>> _______________________________________________
>>> xml2rfc mailing list
>>> xml2rfc@ietf.org
>>> https://www.ietf.org/mailman/listinfo/xml2rfc
>>>
>=20


--JxwNNp04XVRI126pgGunABqxbCPLBnCgJ--

--a8N23vJoSH319wrEXjRBCANQlgtjmljJB
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxezEsACgkQTptXS4+7
FxoOAg/9EprEG6oILbYB6gzIr31pcZeYIYGqajSHujSmSQUUsroM7qXtv7p/8sIR
xPxiqvr7erNG6cZn5XJFwf6Enncby73hwTemgGUChmMXFWBqy5Jd0K9SYu/vtgwm
tOH6srczPIA8SeOZGdxHPDfsALYKUWScbD7y4GOVT9LRCh6E9fiDIfAMrHrsCERD
6fxqXvuPoldaAaKR/RRPrB1dC7JKYI/lmjg6QkIEndSK+FMNFnSio8QuS7hL7r2c
e2q5lATPzUlnNSQaPJgNIzv3YAsLiMEoaAo/Tvl7TQVgd4TW3qZqMXc3WfqLU80x
nFdmEXaWjOv6D4KCS8S0V38QGVOHjvJIrqR9z8hwr06+En/f0TGlHaqBs2eIlYZU
AHoZT3hOx9qDY3GqcNE+VZcqOnKHcv8PDvzyxrx2vA9lV4kvWmHUvWaRNFiag9Rk
Uaf+VB9El33FuHhkImEMF6LMjJrGb+A5TFoAaR3sDFkYwu5j6I/JRqTfSgK8w0yy
W6OjjIOQ3ZfRiH7HYbIcQ6mo7bSEeWEUuJl9hTcTxPAercx5MG7nCsez8q3ePg3L
LeSiaGtg758Bje133pTgtC08VLOehCJzY6Z2KsMiyoT0rB9AgqnZuXybp6AcUdUa
aZO5AUvTyUB/yuUtGUePaNnO9wb+FLPm/OKeVkAeDnsGJoIzgMM=
=iFFS
-----END PGP SIGNATURE-----

--a8N23vJoSH319wrEXjRBCANQlgtjmljJB--


From nobody Sun Feb 10 09:34:42 2019
Return-Path: <chopps@chopps.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id C3B63127287 for <xml2rfc@ietfa.amsl.com>; Sun, 10 Feb 2019 09:34:40 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_NONE=-0.0001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id saWIl7tivvke for <xml2rfc@ietfa.amsl.com>; Sun, 10 Feb 2019 09:34:39 -0800 (PST)
Received: from smtp.chopps.org (smtp.chopps.org [54.88.81.56]) by ietfa.amsl.com (Postfix) with ESMTP id BBD2B1200D7 for <xml2rfc@ietf.org>; Sun, 10 Feb 2019 09:34:39 -0800 (PST)
Received: from tops.chopps.org (047-050-069-038.biz.spectrum.com [47.50.69.38]) (using TLSv1.2 with cipher AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by smtp.chopps.org (Postfix) with ESMTPS id E0F3260450; Sun, 10 Feb 2019 12:34:38 -0500 (EST)
User-agent: mu4e 1.1.0; emacs 26.1
From: Christian Hopps <chopps@chopps.org>
To: XML2RFC Interest Group <xml2rfc@ietf.org>
Cc: chopps@chopps.org
Date: Sun, 10 Feb 2019 12:34:38 -0500
Message-ID: <sa6k1i7lf81.fsf@chopps.org>
MIME-Version: 1.0
Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature"
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/aaRGrgyIS-2hxhXwo51NZss8-1A>
Subject: [xml2rfc] XREF to appendix bad expansion.
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Sun, 10 Feb 2019 17:34:41 -0000

--=-=-=
Content-Type: text/plain; format=flowed


I have:

    see <xref target="org329799d"/>.
    ...<back>...
    <section title="Some Title Text" anchor="org329799d">

When I run this through xml2rfc (--v3 --text) I get:

    see Section appendix.a.
    ...
    Appendix A.  Some Title Text

I would have expected:

    see Appendix A.
    ...
    Appendix A.  Some Title Text

Is this a bug?

Thanks,
Chris.

--=-=-=
Content-Type: application/pgp-signature; name="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCgAdFiEEm56yH/NF+m1FHa6lLh2DDte4MCUFAlxgYK4ACgkQLh2DDte4
MCWA9g//VGB6AE4BhJU6zim3eDB5fYI8ifWp5LZ1vnFYbLZ198W5AnZmMUqtgRM+
mDeNwJYXrm1uxlbIzAKMJWTT+yYL5G++/pEl3jgNGrgmbR9v+twsrLNXcs34kJqN
QCAoPw4z5PezVXzEuKXBbJEiSxxN9em+UFNIVZwKg4I0snFL15zzQiBVIHjtouba
GEuXiNZ8tKfebFTgi6F/b/VOmhcL8wgUHcuYbMJN9t3hBefJHP1ta5OTi3fr1n7/
8Nq7VdQx+u/Xu1TcRhPAYwxGsmrI4yYpKl6/5DLmv8CxeMErVBEqM1pbHJHLCrdM
P7LCApCDQBxpifTiIaPiuiYFxnvU3YMb19UNDChvYntH7uQoYi+scbVSz1eWl2xK
KjvaxdFZF9j7mLyTANk0DBWCkA5qd4dhs+x6X5qOJEJTSrMUYVOjrrdM7l4ErWc8
mtmCgkXVYxvAo8aJBXpttk6rcLlDQucnXKoOPNDR5AhcNVdL/4d0poRiHowoRxqR
W3zyPRqT2GMEo9Q066V7pzQfMVaoEu8r/bG2NehlLK0zJa/OOxGcdIJxh+ZcHfzj
JhLGqj/1IiJG4bC6dnlMhnXxeOMv7IsNjt8+vwVjeHbD2o9HEAxJJlRKyIM7fEE4
h0Ztw4tCRNoqufQYNnzn6cG9rzYxBBWI223T86NgiYlpVlKDN4E=
=Jwoy
-----END PGP SIGNATURE-----
--=-=-=--


From nobody Sun Feb 10 11:13:39 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 9223F129AA0 for <xml2rfc@ietfa.amsl.com>; Sun, 10 Feb 2019 11:13:37 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id dhprhBR3WIUZ for <xml2rfc@ietfa.amsl.com>; Sun, 10 Feb 2019 11:13:36 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id DFC15128CF2 for <xml2rfc@ietf.org>; Sun, 10 Feb 2019 11:13:35 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:54639 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gsuXm-0004vT-NT; Sun, 10 Feb 2019 11:13:35 -0800
To: Christian Hopps <chopps@chopps.org>, XML2RFC Interest Group <xml2rfc@ietf.org>
References: <sa6k1i7lf81.fsf@chopps.org>
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <a8e8d3d7-030f-f763-4f22-d93e702ba75b@levkowetz.com>
Date: Sun, 10 Feb 2019 20:13:11 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <sa6k1i7lf81.fsf@chopps.org>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="rIPLVMNHuVIaV2awsgKRhJkWVVbXXbpNo"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, chopps@chopps.org
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/J7YI43ewsaZW3Q33qq1kUrWKF6A>
Subject: Re: [xml2rfc] XREF to appendix bad expansion.
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Sun, 10 Feb 2019 19:13:38 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--rIPLVMNHuVIaV2awsgKRhJkWVVbXXbpNo
Content-Type: multipart/mixed; boundary="MW0cwg1fOO6HOWfoIasTtgJ2jcitDf80d";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Christian Hopps <chopps@chopps.org>,
 XML2RFC Interest Group <xml2rfc@ietf.org>
Message-ID: <a8e8d3d7-030f-f763-4f22-d93e702ba75b@levkowetz.com>
Subject: Re: [xml2rfc] XREF to appendix bad expansion.
References: <sa6k1i7lf81.fsf@chopps.org>
In-Reply-To: <sa6k1i7lf81.fsf@chopps.org>

--MW0cwg1fOO6HOWfoIasTtgJ2jcitDf80d
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable

Hi Chris,

On 2019-02-10 18:34, Christian Hopps wrote:
>=20
> I have:
>=20
>     see <xref target=3D"org329799d"/>.
>     ...<back>...
>     <section title=3D"Some Title Text" anchor=3D"org329799d">
>=20
> When I run this through xml2rfc (--v3 --text) I get:
>=20
>     see Section appendix.a.
>     ...
>     Appendix A.  Some Title Text
>=20
> I would have expected:
>=20
>     see Appendix A.
>     ...
>     Appendix A.  Some Title Text
>=20
> Is this a bug?

Yes.  Will fix.  Thanks for the report!

	Henrik


--MW0cwg1fOO6HOWfoIasTtgJ2jcitDf80d--

--rIPLVMNHuVIaV2awsgKRhJkWVVbXXbpNo
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxgd8cACgkQTptXS4+7
FxoQghAAp6c6iXEW1yq3jbXasrg6XM9FxGS9DzcJuavZ9QfJLij7X7WDmsMnpAuL
leAXBhxes0cap/RYogonTKxmHhi3/jzt44Hbht9W9hxGnu8xDv/SAc7zWFn7ak1r
2gStAyA9youxogHtnOIB6BPIASHwGmvm8D9EhZc4h6wl4tRWnp0sOOhLATTL9oJD
oG57voQCq3QTzAWToLfF0sLG7dTuwzUZkpxuM+5cuJYrWhkhSUKDZXhNGC8gFOr3
dxE9+anO4q1QG6Or/LuhnqEEpm98uuO5tto5S3gq2BY5yZHIfE4WvX4G7Myvw/bQ
fCYYNJQhcaOihh/kVL6YlB742LWqvGd8ry5LiESD8v1LK0W9I40B48MrxzE1ioMF
X4PQ9Zlzmyry385hJ6PH99HnGav36Snh3PbiI2cvwv4M8Jq9ofAUc9LUo2aKeDTj
78PeVKeXPiKT0UyQk6QzC7bNYhJ7Bx18rc1RdtmuceUC3XNRvekwceNqGSLttPfG
7AhcBCssLlzQl9nXsUj3P+1s2l9FpwZfGS3kPhP4ZR9RksDFBohSxGUOnoRCN1Gs
eKSA1Tb0NKW4t6ax8zKyAsZxyzrmUdceANdEBS5k5nCrmYtRkQMSKvYmkPfaDmq2
nRl1aMG+xgRvdvmb8eaTO6uz9ttbXLzQT7jGc2dApRx/c7Axuwk=
=Y/Gu
-----END PGP SIGNATURE-----

--rIPLVMNHuVIaV2awsgKRhJkWVVbXXbpNo--


From nobody Mon Feb 11 05:04:54 2019
Return-Path: <rse@rfc-editor.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 0FD8512E7C1 for <xml2rfc@ietfa.amsl.com>; Mon, 11 Feb 2019 05:04:53 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -4.2
X-Spam-Level: 
X-Spam-Status: No, score=-4.2 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_MED=-2.3, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id q2pURGEg0euf for <xml2rfc@ietfa.amsl.com>; Mon, 11 Feb 2019 05:04:51 -0800 (PST)
Received: from mail.amsl.com (c8a.amsl.com [4.31.198.40]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 21B8212008A for <xml2rfc@ietf.org>; Mon, 11 Feb 2019 05:04:51 -0800 (PST)
Received: from localhost (localhost [127.0.0.1]) by c8a.amsl.com (Postfix) with ESMTP id 78F541C5EBA; Mon, 11 Feb 2019 05:04:47 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
Received: from c8a.amsl.com ([127.0.0.1]) by localhost (c8a.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id JCwIR6n3rojr; Mon, 11 Feb 2019 05:04:47 -0800 (PST)
Received: from [10.202.234.109] (unknown [195.245.225.248]) by c8a.amsl.com (Postfix) with ESMTPSA id 796061C5EB5; Mon, 11 Feb 2019 05:04:46 -0800 (PST)
Content-Type: text/plain; charset=us-ascii
Mime-Version: 1.0 (Mac OS X Mail 12.2 \(3445.102.3\))
From: Heather Flanagan <rse@rfc-editor.org>
In-Reply-To: <2a44e1ac-c833-f80c-959c-de5ce6bf1c0a@levkowetz.com>
Date: Mon, 11 Feb 2019 05:04:47 -0800
Cc: Miek Gieben <miek@miek.nl>, Christian Hopps <chopps@chopps.org>, XML2RFC Interest Group <xml2rfc@ietf.org>
Content-Transfer-Encoding: quoted-printable
Message-Id: <07892E09-4B55-485C-9F4D-7A65DFFA80F7@rfc-editor.org>
References: <sa6va1tvre3.fsf@chopps.org> <CAJrXxAPX8u1GyXq9EqzVA3WRC_HD8uxFOO6Tn3f1+2QJrZexqg@mail.gmail.com> <2a44e1ac-c833-f80c-959c-de5ce6bf1c0a@levkowetz.com>
To: Henrik Levkowetz <henrik@levkowetz.com>
X-Mailer: Apple Mail (2.3445.102.3)
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/QbKjTrnSSGS6rtb6yAP4-HuLTn8>
Subject: Re: [xml2rfc] Pagination missing in v3 format (xml2rfc 2.18.0)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 11 Feb 2019 13:04:53 -0000

Hi folks,

> On Feb 9, 2019, at 1:20 AM, Henrik Levkowetz <henrik@levkowetz.com> =
wrote:
>=20
>=20
> Yes, I got the impression that the v3 design team wanted it that way.  =
But
> it seems that the IESG may want pagination for draft submissions, so =
we
> could still be getting an option to do pagination.


For this one, yes, pagination was a rather contentious issue and the =
final rough consensus in the design team was to not support it in the =
plain text. The ToC is still considered of value in that it provides =
ordering and summary of material, and people can jump/text search down =
to the section they are looking for.

The IESG has not discussed pagination for draft submissions as far as I =
know.

-Heather

>=20
> 	Henrik
>=20
> On 2019-02-09 09:50, Miek Gieben wrote:
>> This is by design. In the text output there are no pages, just a long
>> stretch of text.
>>=20
>> On Fri, 8 Feb 2019, 22:37 Christian Hopps <chopps@chopps.org wrote:
>>=20
>>>=20
>>> So I switched to V3 xml2rfc format, mostly to get <dl><dt><dd> =
lists, and
>>> I cannot seem to get xml2rfc to produce paginated output. The TOC is
>>> missing page numbers, which makes sense b/c there are no page
>>> breaks/headers/footers/etc. When I do an HTML output the TOC is =
missing
>>> altogether.
>>>=20
>>> Is there something extra I need to do to get pagination?
>>>=20
>>> Thanks,
>>> Chris.
>>> _______________________________________________
>>> xml2rfc mailing list
>>> xml2rfc@ietf.org
>>> https://www.ietf.org/mailman/listinfo/xml2rfc
>>>=20
>>=20
>>=20
>>=20
>> _______________________________________________
>> xml2rfc mailing list
>> xml2rfc@ietf.org
>> https://www.ietf.org/mailman/listinfo/xml2rfc
>>=20
>=20
> _______________________________________________
> xml2rfc mailing list
> xml2rfc@ietf.org
> https://www.ietf.org/mailman/listinfo/xml2rfc


From nobody Mon Feb 11 05:33:33 2019
Return-Path: <cabo@tzi.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 200D1130E8F for <xml2rfc@ietfa.amsl.com>; Mon, 11 Feb 2019 05:33:31 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -4.2
X-Spam-Level: 
X-Spam-Status: No, score=-4.2 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_MED=-2.3] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id NHV13NyhNgPm for <xml2rfc@ietfa.amsl.com>; Mon, 11 Feb 2019 05:33:29 -0800 (PST)
Received: from mailhost.informatik.uni-bremen.de (mailhost.informatik.uni-bremen.de [IPv6:2001:638:708:30c9::12]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id D5EA6129BBF for <xml2rfc@ietf.org>; Mon, 11 Feb 2019 05:33:28 -0800 (PST)
X-Virus-Scanned: amavisd-new at informatik.uni-bremen.de
Received: from submithost.informatik.uni-bremen.de (submithost2.informatik.uni-bremen.de [134.102.200.7]) by mailhost.informatik.uni-bremen.de (8.14.5/8.14.5) with ESMTP id x1BDXH0d025680; Mon, 11 Feb 2019 14:33:22 +0100 (CET)
Received: from sev.informatik.uni-bremen.de (sev.informatik.uni-bremen.de [134.102.218.54]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by submithost.informatik.uni-bremen.de (Postfix) with ESMTPSA id 43ymvK1VJQz1Br6; Mon, 11 Feb 2019 14:33:17 +0100 (CET)
Content-Type: text/plain; charset=utf-8
Mime-Version: 1.0 (Mac OS X Mail 11.5 \(3445.9.1\))
From: Carsten Bormann <cabo@tzi.org>
In-Reply-To: <07892E09-4B55-485C-9F4D-7A65DFFA80F7@rfc-editor.org>
Date: Mon, 11 Feb 2019 14:33:16 +0100
Cc: Henrik Levkowetz <henrik@levkowetz.com>, XML2RFC Interest Group <xml2rfc@ietf.org>, Christian Hopps <chopps@chopps.org>
X-Mao-Original-Outgoing-Id: 571584794.703927-3542612e6c6a41b3f8ec56c721b04840
Content-Transfer-Encoding: quoted-printable
Message-Id: <5E1CF2FC-32B5-41A1-9198-AFCAE74393C8@tzi.org>
References: <sa6va1tvre3.fsf@chopps.org> <CAJrXxAPX8u1GyXq9EqzVA3WRC_HD8uxFOO6Tn3f1+2QJrZexqg@mail.gmail.com> <2a44e1ac-c833-f80c-959c-de5ce6bf1c0a@levkowetz.com> <07892E09-4B55-485C-9F4D-7A65DFFA80F7@rfc-editor.org>
To: Heather Flanagan <rse@rfc-editor.org>
X-Mailer: Apple Mail (2.3445.9.1)
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/dJGnVjncqnyTDKge_O5-vsX-k9Q>
Subject: Re: [xml2rfc] Pagination missing in v3 format (xml2rfc 2.18.0)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 11 Feb 2019 13:33:31 -0000

I think the confusion is about the transition strategy.
Right now, I can=E2=80=99t ask authors to start working with v3, and if =
the v3 tools continue to not support the transition, that may never =
happen.
How are we planning to get there?  In a Big Bang?

Gr=C3=BC=C3=9Fe, Carsten


From nobody Mon Feb 11 05:39:16 2019
Return-Path: <rse@rfc-editor.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 82671130EDE for <xml2rfc@ietfa.amsl.com>; Mon, 11 Feb 2019 05:39:15 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -4.2
X-Spam-Level: 
X-Spam-Status: No, score=-4.2 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_MED=-2.3, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id pTM1D5DgWmaP for <xml2rfc@ietfa.amsl.com>; Mon, 11 Feb 2019 05:39:14 -0800 (PST)
Received: from mail.amsl.com (c8a.amsl.com [4.31.198.40]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 45353129BBF for <xml2rfc@ietf.org>; Mon, 11 Feb 2019 05:39:14 -0800 (PST)
Received: from localhost (localhost [127.0.0.1]) by c8a.amsl.com (Postfix) with ESMTP id CCFF51C5EBA; Mon, 11 Feb 2019 05:39:10 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
Received: from c8a.amsl.com ([127.0.0.1]) by localhost (c8a.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id KOt2IJJth8Jq; Mon, 11 Feb 2019 05:39:10 -0800 (PST)
Received: from [10.202.234.109] (unknown [195.245.225.248]) by c8a.amsl.com (Postfix) with ESMTPSA id 388B51C5EB8; Mon, 11 Feb 2019 05:39:10 -0800 (PST)
Content-Type: text/plain; charset=utf-8
Mime-Version: 1.0 (Mac OS X Mail 12.2 \(3445.102.3\))
From: Heather Flanagan <rse@rfc-editor.org>
In-Reply-To: <5E1CF2FC-32B5-41A1-9198-AFCAE74393C8@tzi.org>
Date: Mon, 11 Feb 2019 05:39:11 -0800
Cc: XML2RFC Interest Group <xml2rfc@ietf.org>
Content-Transfer-Encoding: quoted-printable
Message-Id: <9729AA4D-635A-4101-9ACA-6100C80F4BD0@rfc-editor.org>
References: <sa6va1tvre3.fsf@chopps.org> <CAJrXxAPX8u1GyXq9EqzVA3WRC_HD8uxFOO6Tn3f1+2QJrZexqg@mail.gmail.com> <2a44e1ac-c833-f80c-959c-de5ce6bf1c0a@levkowetz.com> <07892E09-4B55-485C-9F4D-7A65DFFA80F7@rfc-editor.org> <5E1CF2FC-32B5-41A1-9198-AFCAE74393C8@tzi.org>
To: Carsten Bormann <cabo@tzi.org>
X-Mailer: Apple Mail (2.3445.102.3)
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/7WwC4XNQ8gnKYGZ_FyZ9_G5_d7E>
Subject: Re: [xml2rfc] Pagination missing in v3 format (xml2rfc 2.18.0)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 11 Feb 2019 13:39:15 -0000

> On Feb 11, 2019, at 5:33 AM, Carsten Bormann <cabo@tzi.org> wrote:
>=20
> I think the confusion is about the transition strategy.
> Right now, I can=E2=80=99t ask authors to start working with v3, and =
if the v3 tools continue to not support the transition, that may never =
happen.
> How are we planning to get there?  In a Big Bang?
>=20
> Gr=C3=BC=C3=9Fe, Carsten
>=20


A Big Bang would =E2=80=A6 really hurt. Let=E2=80=99s not do that.=20

I am working with the project team on a plan. First step will be for the =
data tracker to accept v3 drafts; I don=E2=80=99t see this happening =
until (shortly) after IETF 104. Until then, we definitely appreciate =
community testers, but it=E2=80=99s not a terribly organized or =
coordinated activity.=20

I=E2=80=99ll post more information when I have it.

-HEather=


From nobody Mon Feb 11 05:44:14 2019
Return-Path: <chopps@chopps.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 4B850130DC2 for <xml2rfc@ietfa.amsl.com>; Mon, 11 Feb 2019 05:44:12 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_NONE=-0.0001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id CfUuLgbkRdR9 for <xml2rfc@ietfa.amsl.com>; Mon, 11 Feb 2019 05:44:10 -0800 (PST)
Received: from smtp.chopps.org (smtp.chopps.org [54.88.81.56]) by ietfa.amsl.com (Postfix) with ESMTP id 02AF312008A for <xml2rfc@ietf.org>; Mon, 11 Feb 2019 05:44:09 -0800 (PST)
Received: from tops.chopps.org (047-050-069-038.biz.spectrum.com [47.50.69.38]) (using TLSv1.2 with cipher AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by smtp.chopps.org (Postfix) with ESMTPS id 2ACD960427; Mon, 11 Feb 2019 08:44:08 -0500 (EST)
References: <sa6va1tvre3.fsf@chopps.org> <CAJrXxAPX8u1GyXq9EqzVA3WRC_HD8uxFOO6Tn3f1+2QJrZexqg@mail.gmail.com> <2a44e1ac-c833-f80c-959c-de5ce6bf1c0a@levkowetz.com> <07892E09-4B55-485C-9F4D-7A65DFFA80F7@rfc-editor.org>
User-agent: mu4e 1.1.0; emacs 26.1
From: Christian Hopps <chopps@chopps.org>
To: Heather Flanagan <rse@rfc-editor.org>
Cc: Henrik Levkowetz <henrik@levkowetz.com>, Miek Gieben <miek@miek.nl>, Christian Hopps <chopps@chopps.org>, XML2RFC Interest Group <xml2rfc@ietf.org>
In-reply-to: <07892E09-4B55-485C-9F4D-7A65DFFA80F7@rfc-editor.org>
Date: Mon, 11 Feb 2019 08:44:07 -0500
Message-ID: <sa65ztqmod4.fsf@chopps.org>
MIME-Version: 1.0
Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature"
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/UWiDPtYN9RkMDbsGwqK6RLX6GYI>
Subject: Re: [xml2rfc] Pagination missing in v3 format (xml2rfc 2.18.0)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 11 Feb 2019 13:44:12 -0000

--=-=-=
Content-Type: text/plain; format=flowed


I warmed up to it after learning it wasn't a bug. All those headers and footers and wasted space and weird diffs not worth it. :)

Thanks,
Chris.

Heather Flanagan <rse@rfc-editor.org> writes:

> Hi folks,
>
>> On Feb 9, 2019, at 1:20 AM, Henrik Levkowetz <henrik@levkowetz.com> wrote:
>>
>>
>> Yes, I got the impression that the v3 design team wanted it that way.  But
>> it seems that the IESG may want pagination for draft submissions, so we
>> could still be getting an option to do pagination.
>
>
> For this one, yes, pagination was a rather contentious issue and the final rough consensus in the design team was to not support it in the plain text. The ToC is still considered of value in that it provides ordering and summary of material, and people can jump/text search down to the section they are looking for.
>
> The IESG has not discussed pagination for draft submissions as far as I know.
>
> -Heather
>
>>
>> 	Henrik
>>
>> On 2019-02-09 09:50, Miek Gieben wrote:
>>> This is by design. In the text output there are no pages, just a long
>>> stretch of text.
>>>
>>> On Fri, 8 Feb 2019, 22:37 Christian Hopps <chopps@chopps.org wrote:
>>>
>>>>
>>>> So I switched to V3 xml2rfc format, mostly to get <dl><dt><dd> lists, and
>>>> I cannot seem to get xml2rfc to produce paginated output. The TOC is
>>>> missing page numbers, which makes sense b/c there are no page
>>>> breaks/headers/footers/etc. When I do an HTML output the TOC is missing
>>>> altogether.
>>>>
>>>> Is there something extra I need to do to get pagination?
>>>>
>>>> Thanks,
>>>> Chris.
>>>> _______________________________________________
>>>> xml2rfc mailing list
>>>> xml2rfc@ietf.org
>>>> https://www.ietf.org/mailman/listinfo/xml2rfc
>>>>
>>>
>>>
>>>
>>> _______________________________________________
>>> xml2rfc mailing list
>>> xml2rfc@ietf.org
>>> https://www.ietf.org/mailman/listinfo/xml2rfc
>>>
>>
>> _______________________________________________
>> xml2rfc mailing list
>> xml2rfc@ietf.org
>> https://www.ietf.org/mailman/listinfo/xml2rfc


--=-=-=
Content-Type: application/pgp-signature; name="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCgAdFiEEm56yH/NF+m1FHa6lLh2DDte4MCUFAlxhfCcACgkQLh2DDte4
MCVK1A//c3mdEAQKdzClkYPztDVdmkQIGhDju+j1vSZT2exzUcl2POQwwiWk5p17
dr9QDpYa/6imdPV2pqqhXMyJPUsy0m55Ih04GhvP21Y13yHm7oJNQrqbhzUBG5IE
z8fvcLN5eOIBB4NYd/BpgyXuOpeLb5/nWoIN2p+FawW15iTQBZIWKZiP+hGfALES
1PEcRhkqYoqRzfaH0ITS4cKzgEeiWMuydtE7z2bLxBFfoWiDBiZcvmGwm5ftlIPo
Hei0b2ACk/wMf+H1pQsaYCm2u5A3XQe9biipzWoiMnuz/AkwlrXbYAV0p1QN0vvt
rz28WZetim9HSv0a4s+ui/ATyHbCi7j130zawu+G9a7CKyH1puLUp+oHpfKCbrYD
WcPvmwSMOJiWPUQWbJegc4keYRU8ot83pOARQ48yMbAYsmjdal34BqNGtxyGV4FH
22+8Ak55Hxokhnndsc6HjMDswG41X+Fw+aZLN8aoRUwupdqOoikdcIRj0W202Txe
1exg1LaeCVdBXlrMN4pBwyqnHe6GfZ95DZGTafPvWSKj/ToaT1cmzVWIQGmpDflj
UUTYC/7ophHHNjReOpwBrRGl+NIdteOTjvqRfv3NDI4z0L/JijB5lvFOVFPUajDk
jIaEr9tXNt3gLT+ul60RlAYBD6kmt8akqzgk9PTCmP9RGn58kKw=
=ad9Y
-----END PGP SIGNATURE-----
--=-=-=--


From nobody Mon Feb 11 06:03:00 2019
Return-Path: <julian.reschke@gmx.de>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 77082131048 for <xml2rfc@ietfa.amsl.com>; Mon, 11 Feb 2019 06:02:54 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -2.6
X-Spam-Level: 
X-Spam-Status: No, score=-2.6 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, FREEMAIL_FROM=0.001, RCVD_IN_DNSWL_LOW=-0.7, SPF_PASS=-0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id iwZn9lPhXNcK for <xml2rfc@ietfa.amsl.com>; Mon, 11 Feb 2019 06:02:51 -0800 (PST)
Received: from mout.gmx.net (mout.gmx.net [212.227.15.18]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 5C6E613105F for <xml2rfc@ietf.org>; Mon, 11 Feb 2019 06:02:51 -0800 (PST)
Received: from [192.168.1.81] ([217.91.35.233]) by mail.gmx.com (mrgmx001 [212.227.17.190]) with ESMTPSA (Nemesis) id 0MQzUc-1gWWkQ2LoE-00UIw9; Mon, 11 Feb 2019 14:57:36 +0100
To: Christian Hopps <chopps@chopps.org>, Heather Flanagan <rse@rfc-editor.org>
Cc: XML2RFC Interest Group <xml2rfc@ietf.org>
References: <sa6va1tvre3.fsf@chopps.org> <CAJrXxAPX8u1GyXq9EqzVA3WRC_HD8uxFOO6Tn3f1+2QJrZexqg@mail.gmail.com> <2a44e1ac-c833-f80c-959c-de5ce6bf1c0a@levkowetz.com> <07892E09-4B55-485C-9F4D-7A65DFFA80F7@rfc-editor.org> <sa65ztqmod4.fsf@chopps.org>
From: Julian Reschke <julian.reschke@gmx.de>
Message-ID: <f7be3ada-b342-2882-776a-e8fc939a388e@gmx.de>
Date: Mon, 11 Feb 2019 14:57:35 +0100
User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; rv:60.0) Gecko/20100101 Thunderbird/60.5.0
MIME-Version: 1.0
In-Reply-To: <sa65ztqmod4.fsf@chopps.org>
Content-Type: text/plain; charset=utf-8; format=flowed
Content-Language: en-US
Content-Transfer-Encoding: 7bit
X-Provags-ID: V03:K1:A6LTmdNoVdY+4W2YgVJBeu/qJod5gEwsz0v6/N/Gs6B85WxPbII 63gWhESTfNSt2IXm4J48I43X3xxQHf4mRfCOmhYpZurDac5K3fuZxykPyR4nSQa8N07sa3N 3uzzghGti47gphj1SFVSN2jaYOoG2kx2HDkCgg68T+5lPGxFBjFBawzyG+DiXiODCIHbz6s +9Rxj1f9xScsZGdsX9FTA==
X-UI-Out-Filterresults: notjunk:1;V03:K0:CBd82e5IGvc=:o3N/e59yMaa4BM4eKQvdHQ iFugOg4kZny4Ipt3A6J42+8Ty6hQEY+4v2edmst7qG3++r7zRjqDTtYM5Kidx+V1kc8OcRkUX uLKrmZoANMCsobv5KKXbYAMuau0I4mYBjJzwxHQZnOYGZ+9auD+VG6kN7g9ZH16oqQD3WWJ2f JLTTAXotIRF0jrxtvp6y5R+18MEETJ2LPkDsgEsCJEXtEUXz0+uf8ISJyWV7oJVeWQRPb/DYs SwVDeMY2C91/kbQ3GuHRFk+wZPi8WRr2gZnE68HblnJQtdoE3bLNBd1JkABGw9Sij+GWR7wxf kPgAz6daxEs0M0Fsl5LlgtNPObpSN39Ayv6DyVmKSG0BGzaaNN0Z0P+XhWzYHDYpbqAmf3+Lo M9E8tQWXeInliJBqCR6V3jdW+qiG/snDrnzstGQQBUISK/ONNFoH4U7/fdcSNizr6fW5wV0/Z sYeUBPZh58yeCikO5ger1XTanHCBTtsOnMUMS37cyTYIlpvvJCvamS16RkqODVzD+VznCWtiU oeuzDeDRQxpww5fCovR8egWriuaduWt1fezjpC+ol7bfPZ7JdPdPk3tcYEiE6vvJ4w2i+AFR3 8s4e8CjNZfMn3/jYo4B8hxUOlPmttNcCQYijWDlfwS8C+GOTgwmTgQtZAcd7RFm6Q32DNH2Fv sLUfaIKhLQ0DZcM8RmgTGSkW1ReUiktiQQ9NyiBle+4FjXxq8c6M8UUdHNMCxszmPde+k6ss8 EFdptTmW3v6iQEw8vQ4MOSovF19eO0eylj/Fzu0Lnxk4Z8t6yEjtcxMCX2/1cW2+hd1kCaW15 g8bUhqjthJd4wRWlaRda+Xa2M24lcKCvjKDPSYZqDOv87CJSF41vI3LenH2T/B6MHrb9nz0xY QRXkXp0eeocq2gVqLJXatfllox3Q+24IRlFCWuOw3DGNUGbaoJtcFmCy6ckjVAiz7as4Ex+kx vTFPSVeiimA==
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/KZ8aesX1anYfu2nw_EOBjbThaxU>
Subject: Re: [xml2rfc] Pagination missing in v3 format (xml2rfc 2.18.0)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 11 Feb 2019 14:02:59 -0000

On 11.02.2019 14:44, Christian Hopps wrote:
> 
> I warmed up to it after learning it wasn't a bug. All those headers and 
> footers and wasted space and weird diffs not worth it. :)
> 
> Thanks,
> Chris.

+1



From nobody Tue Feb 12 03:13:31 2019
Return-Path: <chopps@chopps.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 45BBB130E58 for <xml2rfc@ietfa.amsl.com>; Tue, 12 Feb 2019 03:13:27 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_NONE=-0.0001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id tTl_ibQiNSO9 for <xml2rfc@ietfa.amsl.com>; Tue, 12 Feb 2019 03:13:25 -0800 (PST)
Received: from smtp.chopps.org (smtp.chopps.org [54.88.81.56]) by ietfa.amsl.com (Postfix) with ESMTP id 85F34130DF6 for <xml2rfc@ietf.org>; Tue, 12 Feb 2019 03:13:25 -0800 (PST)
Received: from tops.chopps.org (047-050-069-038.biz.spectrum.com [47.50.69.38]) (using TLSv1.2 with cipher AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by smtp.chopps.org (Postfix) with ESMTPS id CE8E660452; Tue, 12 Feb 2019 06:13:24 -0500 (EST)
References: <sa6k1i7lf81.fsf@chopps.org> <a8e8d3d7-030f-f763-4f22-d93e702ba75b@levkowetz.com>
User-agent: mu4e 1.1.0; emacs 26.1
From: Christian Hopps <chopps@chopps.org>
To: Henrik Levkowetz <henrik@levkowetz.com>
Cc: Christian Hopps <chopps@chopps.org>, XML2RFC Interest Group <xml2rfc@ietf.org>
In-reply-to: <a8e8d3d7-030f-f763-4f22-d93e702ba75b@levkowetz.com>
Date: Tue, 12 Feb 2019 06:13:23 -0500
Message-ID: <sa6y36l1cq4.fsf@chopps.org>
MIME-Version: 1.0
Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature"
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/rqF2VdGSOACQY1qxfq68JhDVwbg>
Subject: Re: [xml2rfc] XREF to appendix bad expansion.
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 12 Feb 2019 11:13:29 -0000

--=-=-=
Content-Type: text/plain; format=flowed


BTW, In trying to work around this I tried to specify the text directly. Unfortunately since the format attribute has lost it's "none" option this seems not possible -- I end up with something like "see Section appendix.a Appendix A." or "see appendix.a. Appendix A." when I specify "Appendix A." as my text. Can we bring back the "none" format attribute? I can't figure out why this attribute value was deprecated TBH, no functionality replaced it.

Thanks,
Chris.

Henrik Levkowetz <henrik@levkowetz.com> writes:

> Hi Chris,
>
> On 2019-02-10 18:34, Christian Hopps wrote:
>>
>> I have:
>>
>>     see <xref target="org329799d"/>.
>>     ...<back>...
>>     <section title="Some Title Text" anchor="org329799d">
>>
>> When I run this through xml2rfc (--v3 --text) I get:
>>
>>     see Section appendix.a.
>>     ...
>>     Appendix A.  Some Title Text
>>
>> I would have expected:
>>
>>     see Appendix A.
>>     ...
>>     Appendix A.  Some Title Text
>>
>> Is this a bug?
>
> Yes.  Will fix.  Thanks for the report!
>
> 	Henrik


--=-=-=
Content-Type: application/pgp-signature; name="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCgAdFiEEm56yH/NF+m1FHa6lLh2DDte4MCUFAlxiqlMACgkQLh2DDte4
MCU0Vg//QxpvsUAJRXlbLX4s3FIqjgyjd7ILm27tej2jtc1N9xNq44tiqHjXVvyd
7RSQMf4I6zKtV3uup2XNFQUzCunWU55oC3rPVbZfso7eT9kbejjmGZ3/2gYtLvLV
lz70FPRCKgnla/QMrbxl7QcK2tMItwbobzqI0lCyekpTaDSeZPsza5bwQ1muSk7Q
vDj+vpBtAlfvvdng6gTd9s/wrL2485OSYAQAAMZ4P3kADhyY7blPOqhzJJivNbPI
M/Y6NSnOnMttORTWkI6f3lrvclci/MkEqspwtsHGjvlpmqcjCSdycb4432yj7JLw
ex2Z/MXlnpYkq6FlB6QQ15mnQnmAPZ9F4l31B6JIS/tGyIuHO3Z/wlTNvaCbxiJV
+OfJUAjVv96xi9qhH9QScwLnRac88PmpOXfUjs/UvhKYjepSBd1lodx6b4loC1MP
EGCBxeOZC+9OxmOBmMPRahrg1VSG11yrjKOIgsiLwLvKkWyYkrRdhpTjyzfxp7xo
MLyWqZQlMUd6yhsT9yGWkYbFo3p0WUJoWOTBc4RCjfVmj1a+9kIKHcDMxDxetY5w
+Oo+gqEZWb5DKOSLG7tdddHTNUNrdsTcQ//SXl/bCAK1wlMTp0ZEZG+1E7U4dn60
9s5AaFIL9NAZbqhyvljZ2uosoxgLtV060f8NoP3p9ZWROWocrwk=
=/+T+
-----END PGP SIGNATURE-----
--=-=-=--


From nobody Tue Feb 12 03:16:20 2019
Return-Path: <chopps@chopps.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 48466128CE4 for <xml2rfc@ietfa.amsl.com>; Tue, 12 Feb 2019 03:16:14 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_NONE=-0.0001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id E4vdUk2be43U for <xml2rfc@ietfa.amsl.com>; Tue, 12 Feb 2019 03:16:12 -0800 (PST)
Received: from smtp.chopps.org (smtp.chopps.org [54.88.81.56]) by ietfa.amsl.com (Postfix) with ESMTP id 9CF2B128AFB for <xml2rfc@ietf.org>; Tue, 12 Feb 2019 03:16:12 -0800 (PST)
Received: from tops.chopps.org (047-050-069-038.biz.spectrum.com [47.50.69.38]) (using TLSv1.2 with cipher AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by smtp.chopps.org (Postfix) with ESMTPS id E55F660452; Tue, 12 Feb 2019 06:16:11 -0500 (EST)
References: <sa6lg2uqobf.fsf@chopps.org> <9d1c955f-9d0f-df99-b2bc-9dccacc7875c@levkowetz.com> <sa6ftt1rdu8.fsf@chopps.org>
User-agent: mu4e 1.1.0; emacs 26.1
From: Christian Hopps <chopps@chopps.org>
To: Henrik Levkowetz <henrik@levkowetz.com>
Cc: Christian Hopps <chopps@chopps.org>, xml2rfc@ietf.org
In-reply-to: <sa6ftt1rdu8.fsf@chopps.org>
Date: Tue, 12 Feb 2019 06:16:11 -0500
Message-ID: <sa6wom51clg.fsf@chopps.org>
MIME-Version: 1.0
Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature"
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/lgspATPkqoxYYASSUkEmnn0FUx4>
Subject: Re: [xml2rfc] <dl>, <dt> and <dd>
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 12 Feb 2019 11:16:14 -0000

--=-=-=
Content-Type: text/plain; format=flowed


Christian Hopps <chopps@chopps.org> writes:

> What I'd really like to do is a direct org mode exporter for emacs directly -- we'll see.

Done.

Waiting on melpa merge for auto-install option before announcing this to ietf@ et al; however, it is available now at:

    https://github.com/choppsv1/org-rfc-export

Thanks,
Chris.

>
> Thanks,
> Chris.
>
> Henrik Levkowetz <henrik@levkowetz.com> writes:
>
>> Hi Christian,
>>
>> On 2019-02-05 15:53, Christian Hopps wrote:
>>> I'm having a heck of a time getting a <dl> (definition list)
>>> working.
>>>
>>> I see in the xml2rfc code that it talks about <dl> and hanging lists
>>> being deprecated etc, but I cannot get xml2rfc to actual produce any
>>> output when I use them. I have to disable DTD validation to even get
>>> it to parse.
>>>
>>> Can someone help me with a short example of using a <dl> that xml2rfc
>>> will understand?
>>
>> I think the issue here is that the legacy parser and formatters don't
>> understand the new vocabulary introduced with RFC 7991.  If you wish
>> to use that, you should give xml2rfc the --v3 switch, in order to tell
>> it to run in v3 mode.
>>
>> Alternatively, you can indicate that your xml source file uses the
>> v3 vocabulary by setting the attribute version="3" on the <rfc> element.
>>
>> When v3 mode is deemed mature, it will become the default, and the xml2rfc
>> version will shift from 2.*.* to 3.*.*.
>>
>>
>> I hope that helps.
>>
>> Regards,
>>
>> 	Henrik

--=-=-=
Content-Type: application/pgp-signature; name="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCgAdFiEEm56yH/NF+m1FHa6lLh2DDte4MCUFAlxiqvsACgkQLh2DDte4
MCX8fA//fdlB07tTTUOXfT34N5TIKgZSV7rQywMKy+8MqlEcMecKF0ViguaVlbNP
Q0hqfKVTUYTrt9CTPVhGWnMtixG7ovzSe8Ywv3g5FvKncVWjcQamOAsRoAhytcu6
tyuEtVYbvmQYPFG1Y1dv0EX8i6TI6VtjNvA0SX76uDcGLjrWa8S9QSWNoW2rNkEZ
pFyYyDY8fNcVraL13FpMn0zJm48eNJjORscvP0xDuIeQVs+FamTxn8h4QZ3Dh9WO
M8dJljJVBWyo78hC4eYD2dwV6HZsoz7Mlaq3UxsPikRlyhwzv4YWo9od0S9cPK83
77kSib9VLy0Gu9HsjuGVJzybXdQE6GL59uBW9MPrKZN9RcS27nvQTGHD/y1Hg6YD
UHEp6xDSRHo9p0/GxqZmVF0hPYOsLZ8d9YMQN8SW+ln/+c11ShCisr2gFGq2Biaw
AU/qOd27KIGweCtsm2JY3Kl3/Zl8GNahFSLfHfrOScltZZNOiL+2FwK4q2xvjW5x
CsP1NkYXA6J4dAtf0hjbmcaNSEgcgMlwBqv3fz9YTBQvOIF/Vg4j5y4CcCNLZEBN
sy+B4xluVXeFnCrDxCxO7ui/Eu0u5RyBQmjxI2wXcSb5OnBuAkjym5g6trQRBlKI
g0GDyxMPcqFcbigdeGgWibFZVjfbzGHvgJAEMGYuz+I2Te3EbKg=
=l+xI
-----END PGP SIGNATURE-----
--=-=-=--


From nobody Tue Feb 12 03:59:22 2019
Return-Path: <julian.reschke@gmx.de>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 4779F12D861 for <xml2rfc@ietfa.amsl.com>; Tue, 12 Feb 2019 03:59:20 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -2.6
X-Spam-Level: 
X-Spam-Status: No, score=-2.6 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, FREEMAIL_FROM=0.001, RCVD_IN_DNSWL_LOW=-0.7, SPF_PASS=-0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id eB96KtZv2K7c for <xml2rfc@ietfa.amsl.com>; Tue, 12 Feb 2019 03:59:18 -0800 (PST)
Received: from mout.gmx.net (mout.gmx.net [212.227.15.19]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 4BDA8124C04 for <xml2rfc@ietf.org>; Tue, 12 Feb 2019 03:59:18 -0800 (PST)
Received: from [192.168.1.34] ([217.91.35.233]) by mail.gmx.com (mrgmx002 [212.227.17.190]) with ESMTPSA (Nemesis) id 0MD9NE-1gsNbT1O7o-00GWA2; Tue, 12 Feb 2019 12:58:59 +0100
To: Christian Hopps <chopps@chopps.org>, Henrik Levkowetz <henrik@levkowetz.com>
Cc: XML2RFC Interest Group <xml2rfc@ietf.org>
References: <sa6k1i7lf81.fsf@chopps.org> <a8e8d3d7-030f-f763-4f22-d93e702ba75b@levkowetz.com> <sa6y36l1cq4.fsf@chopps.org>
From: Julian Reschke <julian.reschke@gmx.de>
Message-ID: <d565eb9f-5223-5694-f714-1d93b3edd819@gmx.de>
Date: Tue, 12 Feb 2019 12:58:57 +0100
User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; rv:60.0) Gecko/20100101 Thunderbird/60.5.0
MIME-Version: 1.0
In-Reply-To: <sa6y36l1cq4.fsf@chopps.org>
Content-Type: text/plain; charset=utf-8; format=flowed
Content-Language: en-US
Content-Transfer-Encoding: 7bit
X-Provags-ID: V03:K1:NQ43gwmrKBjHQwfYL57+etKOAN9TJyVxNQh81aniRltHBNDQkRw WZ8gD+zUJJoOKYk6rJfOGQ87fjwAGiFhAjI73rql4yT9T9YFdg2PO4squ8Nk43zFfhh6Bqj itNeq3DlDQxLlv1JigvAUui2lt2vaaXHNaioALUF9tm3xQ/OB10APqrtoycUvKBqVT3bEPo e1wB6SZjrb3pTQ3VhlY/w==
X-UI-Out-Filterresults: notjunk:1;V03:K0:+Obet+aCyJk=:ZHviWhbBx3GZTpyOnCH6yy 46IDe3dqojIVcUq+Gwh0Aj1/PvjTjVB1cnc672s0OZPjWm7oOtUbhYRMzgwYPZ++1RqejUyfk Qk2s7+lH6MccoFp5wH553a5tyaewf/ExZO/SA6ZFQF0/U0Fx6x/KyufoXPwYtekrEarQBoMSs 1cKV2+FrJ7J4YCopbJJo3na7edUuErCB/lxqNz9k/AScSGfHzcnzk6xYY/AM2PJldX9Srua9A e2jKs6j6x2TCjVED+iqxpXuw/6FYLYr6zZkeaSnv3RMkHcVCTfMTzjNkyDR6c8mnmeVNn73a0 img2B2uCQJHREh0oPaVQZg10ZTGdb9zFP4HIjjAk3+s6kN6zOAlPaw0EzW5ZO5VH5ei6UYjPU c6MgvWXLL3uJEbIai80d9SdmOCEhR+JzDM+hpbEa7TGn78snkPWLcyqvuNEj6Uw96WxvdmFuF L6H303IXtc9Sct5PxfyE8A18kVzSBx8jmAJeety79+BofIPdLjXl+I9jbwSNpT51dOeITxYQ3 jULdD7fIYus3BnQoFaeuZ8EB5sME11KsaOcoa4pASpTO6e17ooBNwOvFZioYFfhSHJrjp39ac 0kiaTriBSfhEx7qsDrABiD1SX7nWuSBalvmCtPZmTWFHv9bUT5CPzEU7wsZza2OLEQhjjZa/J 13hMHL/GlqfMGfC6chVWm/7ZyGyg2nmHO6wGY9NsrvQ3oQw5bAF/53w7mgeyW55W9q/JH1lVa RdsMEsmEAYnLZDNfA8ja6rD4ObKMkHrUk9UJypJBrHUnCoOajWKHDC+amPUhBZ7GSUWtxxlWR gwpgphrlFI0n4GUMfSy0ex/131iUukJ85yN5wti0Py1FJwurfIDWP9uzDElFxSKizO6U9qMG2 3T5F3q47GBjmIs/7X90Q5i3Zaq8E/p3snr5E6Iyz0j4cNMt1spCduPR1BmiQje+mO6JYCwzRA MJhPVDi14sA==
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/v0mkHbXOltxos3T3yApqhD8cRTs>
Subject: Re: [xml2rfc] XREF to appendix bad expansion.
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 12 Feb 2019 11:59:20 -0000

On 12.02.2019 12:13, Christian Hopps wrote:
> 
> BTW, In trying to work around this I tried to specify the text directly. 
> Unfortunately since the format attribute has lost it's "none" option 
> this seems not possible -- I end up with something like "see Section 
> appendix.a Appendix A." or "see appendix.a. Appendix A." when I specify 
> "Appendix A." as my text. Can we bring back the "none" format attribute? 
> I can't figure out why this attribute value was deprecated TBH, no 
> functionality replaced it.
> 
> Thanks,
> Chris.

+1

FWIW, this is issue 
<https://github.com/rfc-format/draft-iab-xml2rfc-v3-bis/issues/17>, 
raised almost two years ago.

Best regards, Julian


From nobody Tue Feb 12 08:30:09 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 99D6D127287 for <xml2rfc@ietfa.amsl.com>; Tue, 12 Feb 2019 08:30:06 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 59zGVY8aW7K0 for <xml2rfc@ietfa.amsl.com>; Tue, 12 Feb 2019 08:30:05 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 63484128766 for <xml2rfc@ietf.org>; Tue, 12 Feb 2019 08:30:05 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:57314 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gtawe-0005Df-E2; Tue, 12 Feb 2019 08:30:04 -0800
To: Christian Hopps <chopps@chopps.org>
References: <sa6k1i7lf81.fsf@chopps.org> <a8e8d3d7-030f-f763-4f22-d93e702ba75b@levkowetz.com> <sa6y36l1cq4.fsf@chopps.org>
Cc: XML2RFC Interest Group <xml2rfc@ietf.org>
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <6093f4d2-cf61-2f11-1dcb-e5a26325c31e@levkowetz.com>
Date: Tue, 12 Feb 2019 17:29:56 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <sa6y36l1cq4.fsf@chopps.org>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="o9sgS27WWu6oltd6mulmfoXjD1igHt9FN"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, chopps@chopps.org
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/FxbSQVrrM8ldfKwUOPQf1iucMMg>
Subject: Re: [xml2rfc] XREF to appendix bad expansion.
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 12 Feb 2019 16:30:07 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--o9sgS27WWu6oltd6mulmfoXjD1igHt9FN
Content-Type: multipart/mixed; boundary="9vKInhXfK3oTxWtm0K3DpD3iQ0vVVpXRs";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Christian Hopps <chopps@chopps.org>
Cc: XML2RFC Interest Group <xml2rfc@ietf.org>
Message-ID: <6093f4d2-cf61-2f11-1dcb-e5a26325c31e@levkowetz.com>
Subject: Re: [xml2rfc] XREF to appendix bad expansion.
References: <sa6k1i7lf81.fsf@chopps.org>
 <a8e8d3d7-030f-f763-4f22-d93e702ba75b@levkowetz.com>
 <sa6y36l1cq4.fsf@chopps.org>
In-Reply-To: <sa6y36l1cq4.fsf@chopps.org>

--9vKInhXfK3oTxWtm0K3DpD3iQ0vVVpXRs
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable

Hi Chris,

On 2019-02-12 12:13, Christian Hopps wrote:
>=20
> BTW, In trying to work around this I tried to specify the text
> directly. Unfortunately since the format attribute has lost it's
> "none" option this seems not possible -- I end up with something like
> "see Section appendix.a Appendix A." or "see appendix.a. Appendix A."
> when I specify "Appendix A." as my text. Can we bring back the "none"
> format attribute? I can't figure out why this attribute value was
> deprecated TBH, no functionality replaced it.

Umm.  Which xref construct did you use that gave this?  The preptool
specification says this:


 5.4.8.1.  "derivedContent" Insertion (with Content)

   For each <xref> element that has content, fill the "derivedContent"
   with the element content, having first trimmed the whitespace from
   ends of content text.  Issue a warning if the "derivedContent"
   attribute already exists and has a different value from what was
   being filled in.

which xml2rfc is written to implement.  This seems to me to indicate
that it should be possible to explicitly supply, and end up with, just
"Appendix A.".  I've been trying to reproduce what you experienced,
but cannot quite get to the same point.  Could you provide the xml that
gives you for instance "see Section appendix.a Appendix A." ?


Best regards,

	Henrik

>=20
> Thanks,
> Chris.
>=20
> Henrik Levkowetz <henrik@levkowetz.com> writes:
>=20
>> Hi Chris,
>>
>> On 2019-02-10 18:34, Christian Hopps wrote:
>>>
>>> I have:
>>>
>>>     see <xref target=3D"org329799d"/>.
>>>     ...<back>...
>>>     <section title=3D"Some Title Text" anchor=3D"org329799d">
>>>
>>> When I run this through xml2rfc (--v3 --text) I get:
>>>
>>>     see Section appendix.a.
>>>     ...
>>>     Appendix A.  Some Title Text
>>>
>>> I would have expected:
>>>
>>>     see Appendix A.
>>>     ...
>>>     Appendix A.  Some Title Text
>>>
>>> Is this a bug?
>>
>> Yes.  Will fix.  Thanks for the report!
>>
>> 	Henrik
>=20


--9vKInhXfK3oTxWtm0K3DpD3iQ0vVVpXRs--

--o9sgS27WWu6oltd6mulmfoXjD1igHt9FN
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxi9IUACgkQTptXS4+7
FxqtyxAAw34Cax6OirMggt2QJq5V8dzwmwNp6JTWGpGa6bO++WVeUptM5VZAfR7p
USRzDbtIVPlro+8Kme9KPsut2GFvin8ur9xqas9OBelT8lRdFN0RTEKphOgxtEDK
Wr0evPx/CgTvbqnErgBiv8nTvS2dLBrkmMx29fb4YQho5/nUrj28jCu8WSG1qwhX
JT0IRYR0A9b+R3OjoWmtSo63BMYbtdWRRJHel1APb6aChtKZy2U9ccYeUVMcjtzF
WqgiC1FpAjmFVGjXFVJ1hUSqnZiVTfgYeyOWSMyP2bkTx6Fy0Kv5k0pddULBFwCh
yNAQfATTZtM7OiAI6k7LosjrP7tglW6SP/UKtQOm4Z/ymbyEyxf6N8Hqa5sFAXy8
VvpxT2KbAsiSc2bOp3dD2vloCXyrNrW5SELLbL2HBxMSt7xiNhlhxF8c/cLNL1y3
bHvp7dG3UXB+AGzhhmFGP3+nrIWbVLwcBHYUq0Ta7mDdXNoI85EoolN2S43U6yrY
Wnj4wEa3CDkRl/KYUDq+PIxTfCduoyTpPQyqHiU+igqcT/wkR6b2kuCMWw+uw6Wy
0P3M3YirnFhti6njPGvlbbMKjedXRNFivutFDspI+Bbo06H3PjdoRwJFRu2uQpot
CCTuYEG4/hGtMu1uR6EMhxnbWW8KkE6QYV4cdFa544HyxWGpZ5Q=
=scba
-----END PGP SIGNATURE-----

--o9sgS27WWu6oltd6mulmfoXjD1igHt9FN--


From nobody Tue Feb 12 08:48:19 2019
Return-Path: <chopps@chopps.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 15EA9129A87 for <xml2rfc@ietfa.amsl.com>; Tue, 12 Feb 2019 08:48:18 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_NONE=-0.0001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id wXxr2lPJxNYC for <xml2rfc@ietfa.amsl.com>; Tue, 12 Feb 2019 08:48:16 -0800 (PST)
Received: from smtp.chopps.org (smtp.chopps.org [54.88.81.56]) by ietfa.amsl.com (Postfix) with ESMTP id 41011128B33 for <xml2rfc@ietf.org>; Tue, 12 Feb 2019 08:48:16 -0800 (PST)
Received: from tops.chopps.org (047-050-069-038.biz.spectrum.com [47.50.69.38]) (using TLSv1.2 with cipher AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by smtp.chopps.org (Postfix) with ESMTPS id 5550160468; Tue, 12 Feb 2019 11:48:15 -0500 (EST)
References: <sa6k1i7lf81.fsf@chopps.org> <a8e8d3d7-030f-f763-4f22-d93e702ba75b@levkowetz.com> <sa6y36l1cq4.fsf@chopps.org> <6093f4d2-cf61-2f11-1dcb-e5a26325c31e@levkowetz.com>
User-agent: mu4e 1.1.0; emacs 26.1
From: Christian Hopps <chopps@chopps.org>
To: Henrik Levkowetz <henrik@levkowetz.com>
Cc: Christian Hopps <chopps@chopps.org>, XML2RFC Interest Group <xml2rfc@ietf.org>
In-reply-to: <6093f4d2-cf61-2f11-1dcb-e5a26325c31e@levkowetz.com>
Date: Tue, 12 Feb 2019 11:48:14 -0500
Message-ID: <sa6mun10x81.fsf@chopps.org>
MIME-Version: 1.0
Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature"
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/eP1Xy190ZCqdVWz5UkvbS5OnyeU>
Subject: Re: [xml2rfc] XREF to appendix bad expansion.
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 12 Feb 2019 16:48:18 -0000

--=-=-=
Content-Type: text/plain; format=flowed


Sorry I got the bad text slightly wrong -- still a problem just different format:

   <t>For ... see <xref target="orgad6414c">Appendix A.</xref></t>

   ... [ after rerferences ]

   <section title="Comparison of ..." anchor="orgad6414c">

yields:

   For see Appendix A.  (Section appendix.a)

Thanks,
Chris.

Henrik Levkowetz <henrik@levkowetz.com> writes:

> Hi Chris,
>
> On 2019-02-12 12:13, Christian Hopps wrote:
>>
>> BTW, In trying to work around this I tried to specify the text
>> directly. Unfortunately since the format attribute has lost it's
>> "none" option this seems not possible -- I end up with something like
>> "see Section appendix.a Appendix A." or "see appendix.a. Appendix A."
>> when I specify "Appendix A." as my text. Can we bring back the "none"
>> format attribute? I can't figure out why this attribute value was
>> deprecated TBH, no functionality replaced it.
>
> Umm.  Which xref construct did you use that gave this?  The preptool
> specification says this:
>
>
>  5.4.8.1.  "derivedContent" Insertion (with Content)
>
>    For each <xref> element that has content, fill the "derivedContent"
>    with the element content, having first trimmed the whitespace from
>    ends of content text.  Issue a warning if the "derivedContent"
>    attribute already exists and has a different value from what was
>    being filled in.
>
> which xml2rfc is written to implement.  This seems to me to indicate
> that it should be possible to explicitly supply, and end up with, just
> "Appendix A.".  I've been trying to reproduce what you experienced,
> but cannot quite get to the same point.  Could you provide the xml that
> gives you for instance "see Section appendix.a Appendix A." ?
>
>
> Best regards,
>
> 	Henrik
>
>>
>> Thanks,
>> Chris.
>>
>> Henrik Levkowetz <henrik@levkowetz.com> writes:
>>
>>> Hi Chris,
>>>
>>> On 2019-02-10 18:34, Christian Hopps wrote:
>>>>
>>>> I have:
>>>>
>>>>     see <xref target="org329799d"/>.
>>>>     ...<back>...
>>>>     <section title="Some Title Text" anchor="org329799d">
>>>>
>>>> When I run this through xml2rfc (--v3 --text) I get:
>>>>
>>>>     see Section appendix.a.
>>>>     ...
>>>>     Appendix A.  Some Title Text
>>>>
>>>> I would have expected:
>>>>
>>>>     see Appendix A.
>>>>     ...
>>>>     Appendix A.  Some Title Text
>>>>
>>>> Is this a bug?
>>>
>>> Yes.  Will fix.  Thanks for the report!
>>>
>>> 	Henrik
>>


--=-=-=
Content-Type: application/pgp-signature; name="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCgAdFiEEm56yH/NF+m1FHa6lLh2DDte4MCUFAlxi+M4ACgkQLh2DDte4
MCUwcxAAjS40AJEo+BkP6B9gkqFeb1zP7sGPUgkKH50mVwED2cBtfu0x7VZLjrDP
fHzRHqClSdVDC0FCf54nTUgMG9VHrfP0nLvOPtZAFtRbTeMgJwzek1+pt+FA4m0u
P0yLLJ3nas5O5oS7CKbEkzX/23AuJT6yxTVb1Dexhpwb6ma24AfdJeZuKHL8MZxf
F8/3mTXGBOiO8hVRE7Xx4eadoR6dxvYu0qJH6bl6+o9nk7jEzvYfa5wdyHTF7KkO
ohKC5mRMspkdiEAQA542dO2P6XIzke9U0KnT/VGq9VK6tAKNJdFAvC9ILau85kvw
ApoSrlYjy5w+ftPqpd19RkhS/wgk6XmzaNfvVSBREgEgRChZ7xWrKb1vFB4sVvw5
CztgDSr7Uu1Dbj8Z633rzTLp1gBSG44YkRkwDshrJGvz2GbMCE+lPsX8PaV63gOz
4r99Elq11MgaCpSO6JvhAlUfiBAqyHp2RRSG5b5Eln8Hr4B7qmnx4WQi9lpp0z79
dC9JaTmf0/WnJcsFoIb7QPHkB+f3hmqgeVMXt7qThs3rwXj17KM+npdrPvxNR6ZP
VF0P+xSEjPLTY1dcBxvHNO9Cg5w+jVamby0Q1oGo7T7ZOQTRTc6TPatDsm7j2asJ
w+BrSk7aKjvRtEFbV/5Uz+45LTNPyBLbuIKTAkNdQRwa0R2he8o=
=W6oc
-----END PGP SIGNATURE-----
--=-=-=--


From nobody Tue Feb 12 09:02:51 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 09065129A87 for <xml2rfc@ietfa.amsl.com>; Tue, 12 Feb 2019 09:02:50 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id AlqHr0DX1EtG for <xml2rfc@ietfa.amsl.com>; Tue, 12 Feb 2019 09:02:48 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id B4FC2128B33 for <xml2rfc@ietf.org>; Tue, 12 Feb 2019 09:02:48 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:57588 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gtbSJ-0001AU-4K; Tue, 12 Feb 2019 09:02:48 -0800
To: Christian Hopps <chopps@chopps.org>
References: <sa6k1i7lf81.fsf@chopps.org> <a8e8d3d7-030f-f763-4f22-d93e702ba75b@levkowetz.com> <sa6y36l1cq4.fsf@chopps.org> <6093f4d2-cf61-2f11-1dcb-e5a26325c31e@levkowetz.com> <sa6mun10x81.fsf@chopps.org>
Cc: XML2RFC Interest Group <xml2rfc@ietf.org>
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <b8054782-3131-afd5-0001-768dde063bdd@levkowetz.com>
Date: Tue, 12 Feb 2019 18:02:39 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <sa6mun10x81.fsf@chopps.org>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="6JVPl4vX78q4m1Eirjm1luD09qLl0tIFb"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, chopps@chopps.org
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/_DQ-JBdj0n0qptGbvenNvB8mn5E>
Subject: Re: [xml2rfc] XREF to appendix bad expansion.
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 12 Feb 2019 17:02:50 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--6JVPl4vX78q4m1Eirjm1luD09qLl0tIFb
Content-Type: multipart/mixed; boundary="oWRWIa60oaK2sewAiE2KHVVw2bKQhbv8c";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Christian Hopps <chopps@chopps.org>
Cc: XML2RFC Interest Group <xml2rfc@ietf.org>
Message-ID: <b8054782-3131-afd5-0001-768dde063bdd@levkowetz.com>
Subject: Re: [xml2rfc] XREF to appendix bad expansion.
References: <sa6k1i7lf81.fsf@chopps.org>
 <a8e8d3d7-030f-f763-4f22-d93e702ba75b@levkowetz.com>
 <sa6y36l1cq4.fsf@chopps.org>
 <6093f4d2-cf61-2f11-1dcb-e5a26325c31e@levkowetz.com>
 <sa6mun10x81.fsf@chopps.org>
In-Reply-To: <sa6mun10x81.fsf@chopps.org>

--oWRWIa60oaK2sewAiE2KHVVw2bKQhbv8c
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable

Hi Christian,

On 2019-02-12 17:48, Christian Hopps wrote:
>=20
> Sorry I got the bad text slightly wrong -- still a problem just differe=
nt format:
>=20
>    <t>For ... see <xref target=3D"orgad6414c">Appendix A.</xref></t>
>=20
>    ... [ after rerferences ]
>=20
>    <section title=3D"Comparison of ..." anchor=3D"orgad6414c">
>=20
> yields:
>=20
>    For see Appendix A.  (Section appendix.a)

Ah.  Ok.  Because the text version doesn't have the html links of the HTM=
L
version, it adds helpful (?) information in the format=3D"default" case.

The current specification (no format=3D"none" support) can be made to do =
what
you want, but works differently from legacy, and (I think) violates the
principle of least surprise.  I will look at making the surprise less and=

provide support for format=3D"none", I think, resolving the issue Julian
pointed to at the same time.

In the upcoming release, your original issue should be resolved.  For
now, you can if you wish work around it with:

 <t>For ... see <xref target=3D"orgad6414c" format=3D"counter">Appendix A=
=2E</xref></t>


Best regards,

	Henrik


>=20
> Thanks,
> Chris.
>=20
> Henrik Levkowetz <henrik@levkowetz.com> writes:
>=20
>> Hi Chris,
>>
>> On 2019-02-12 12:13, Christian Hopps wrote:
>>>
>>> BTW, In trying to work around this I tried to specify the text
>>> directly. Unfortunately since the format attribute has lost it's
>>> "none" option this seems not possible -- I end up with something like=

>>> "see Section appendix.a Appendix A." or "see appendix.a. Appendix A."=

>>> when I specify "Appendix A." as my text. Can we bring back the "none"=

>>> format attribute? I can't figure out why this attribute value was
>>> deprecated TBH, no functionality replaced it.
>>
>> Umm.  Which xref construct did you use that gave this?  The preptool
>> specification says this:
>>
>>
>>  5.4.8.1.  "derivedContent" Insertion (with Content)
>>
>>    For each <xref> element that has content, fill the "derivedContent"=

>>    with the element content, having first trimmed the whitespace from
>>    ends of content text.  Issue a warning if the "derivedContent"
>>    attribute already exists and has a different value from what was
>>    being filled in.
>>
>> which xml2rfc is written to implement.  This seems to me to indicate
>> that it should be possible to explicitly supply, and end up with, just=

>> "Appendix A.".  I've been trying to reproduce what you experienced,
>> but cannot quite get to the same point.  Could you provide the xml tha=
t
>> gives you for instance "see Section appendix.a Appendix A." ?
>>
>>
>> Best regards,
>>
>> 	Henrik
>>
>>>
>>> Thanks,
>>> Chris.
>>>
>>> Henrik Levkowetz <henrik@levkowetz.com> writes:
>>>
>>>> Hi Chris,
>>>>
>>>> On 2019-02-10 18:34, Christian Hopps wrote:
>>>>>
>>>>> I have:
>>>>>
>>>>>     see <xref target=3D"org329799d"/>.
>>>>>     ...<back>...
>>>>>     <section title=3D"Some Title Text" anchor=3D"org329799d">
>>>>>
>>>>> When I run this through xml2rfc (--v3 --text) I get:
>>>>>
>>>>>     see Section appendix.a.
>>>>>     ...
>>>>>     Appendix A.  Some Title Text
>>>>>
>>>>> I would have expected:
>>>>>
>>>>>     see Appendix A.
>>>>>     ...
>>>>>     Appendix A.  Some Title Text
>>>>>
>>>>> Is this a bug?
>>>>
>>>> Yes.  Will fix.  Thanks for the report!
>>>>
>>>> 	Henrik
>>>
>=20


--oWRWIa60oaK2sewAiE2KHVVw2bKQhbv8c--

--6JVPl4vX78q4m1Eirjm1luD09qLl0tIFb
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxi/C8ACgkQTptXS4+7
FxoYHw/+Ibb6/R1BXXIQxy/Ck55HEp9NWEAta5JqUFVT/zjoiSv4WMr740HDehi0
EI8nP7ZcYgd0GU5YSaR76FlvHE2Pw7eEW7j09PFg0C/lr38VAV9NRK16jb5bwiiS
OrtQ8TNC/fvRtVO/YtYkIspXlj68JGn50x2u7cdD6kJpm3BwCeXoXLaZUaaM2lJk
h4wqNooTyfbWN9K1gTSnB0Vp338rNGOf6ctV2nRNiyzmjWHla6mMQsbiw3g0HbiG
ctIQMxeEWwSryKu16zmRIVYkXg2wthTnkbcJkcVZ579PmZO7lP+z/TaGDyqUp6ah
f1cbN9tr9ax9RxDwR5R1NeF9Ujd44f772v44iFXcU2odxvuKfX390hiyIPJn28Q9
hmM42I5Mmd+B/A+/7CnG+5KhWVACdiSa0rduR38WNwrEw/TOnDHvQl6fgJpK3Fb0
XjghAxm5SF/1BOl91cQRNO+SiFTrHHoqoN7k4xRmECYDWO7mBju5Nwy2qd/FoT4L
BDOQerrqX1F2fFghDwLL0XVg0vwdsn/TpDgg9I+0i82o51fvEWcqN/Tr9qEOOGLo
WgIScXahtCke1spaThD3uYvSBEgEbcr5EuP3nnoVZYaXK+5HF0kS93bHky8LXp34
SC2sgipCfLc3W2vB8cIJxl6kulLazox/gPcuVXbg6RNUSPXAboo=
=oUyj
-----END PGP SIGNATURE-----

--6JVPl4vX78q4m1Eirjm1luD09qLl0tIFb--


From nobody Tue Feb 12 09:06:21 2019
Return-Path: <chopps@chopps.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id CA1CF1292F1 for <xml2rfc@ietfa.amsl.com>; Tue, 12 Feb 2019 09:06:19 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_NONE=-0.0001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 4KRlFcbCPWmm for <xml2rfc@ietfa.amsl.com>; Tue, 12 Feb 2019 09:06:18 -0800 (PST)
Received: from smtp.chopps.org (smtp.chopps.org [54.88.81.56]) by ietfa.amsl.com (Postfix) with ESMTP id 331E5128B33 for <xml2rfc@ietf.org>; Tue, 12 Feb 2019 09:06:18 -0800 (PST)
Received: from tops.chopps.org (047-050-069-038.biz.spectrum.com [47.50.69.38]) (using TLSv1.2 with cipher AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by smtp.chopps.org (Postfix) with ESMTPS id 86C3C60468; Tue, 12 Feb 2019 12:06:17 -0500 (EST)
References: <sa6k1i7lf81.fsf@chopps.org> <a8e8d3d7-030f-f763-4f22-d93e702ba75b@levkowetz.com> <sa6y36l1cq4.fsf@chopps.org> <6093f4d2-cf61-2f11-1dcb-e5a26325c31e@levkowetz.com> <sa6mun10x81.fsf@chopps.org> <b8054782-3131-afd5-0001-768dde063bdd@levkowetz.com>
User-agent: mu4e 1.1.0; emacs 26.1
From: Christian Hopps <chopps@chopps.org>
To: Henrik Levkowetz <henrik@levkowetz.com>
Cc: Christian Hopps <chopps@chopps.org>, XML2RFC Interest Group <xml2rfc@ietf.org>
In-reply-to: <b8054782-3131-afd5-0001-768dde063bdd@levkowetz.com>
Date: Tue, 12 Feb 2019 12:06:16 -0500
Message-ID: <sa6va1p9bsn.fsf@chopps.org>
MIME-Version: 1.0
Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature"
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/nMU-os4JoOFFRPPZ4AwnFa5QeN8>
Subject: Re: [xml2rfc] XREF to appendix bad expansion.
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 12 Feb 2019 17:06:20 -0000

--=-=-=
Content-Type: text/plain; format=flowed

Yeah,

I just noticed that "counter" worked. I thought I tried them all but apparently not. I think adding "none" to force no extra text is a fine solution.

Thanks,
Chris.

Henrik Levkowetz <henrik@levkowetz.com> writes:

> Hi Christian,
>
> On 2019-02-12 17:48, Christian Hopps wrote:
>>
>> Sorry I got the bad text slightly wrong -- still a problem just different format:
>>
>>    <t>For ... see <xref target="orgad6414c">Appendix A.</xref></t>
>>
>>    ... [ after rerferences ]
>>
>>    <section title="Comparison of ..." anchor="orgad6414c">
>>
>> yields:
>>
>>    For see Appendix A.  (Section appendix.a)
>
> Ah.  Ok.  Because the text version doesn't have the html links of the HTML
> version, it adds helpful (?) information in the format="default" case.
>
> The current specification (no format="none" support) can be made to do what
> you want, but works differently from legacy, and (I think) violates the
> principle of least surprise.  I will look at making the surprise less and
> provide support for format="none", I think, resolving the issue Julian
> pointed to at the same time.
>
> In the upcoming release, your original issue should be resolved.  For
> now, you can if you wish work around it with:
>
>  <t>For ... see <xref target="orgad6414c" format="counter">Appendix A.</xref></t>
>
>
> Best regards,
>
> 	Henrik
>
>
>>
>> Thanks,
>> Chris.
>>
>> Henrik Levkowetz <henrik@levkowetz.com> writes:
>>
>>> Hi Chris,
>>>
>>> On 2019-02-12 12:13, Christian Hopps wrote:
>>>>
>>>> BTW, In trying to work around this I tried to specify the text
>>>> directly. Unfortunately since the format attribute has lost it's
>>>> "none" option this seems not possible -- I end up with something like
>>>> "see Section appendix.a Appendix A." or "see appendix.a. Appendix A."
>>>> when I specify "Appendix A." as my text. Can we bring back the "none"
>>>> format attribute? I can't figure out why this attribute value was
>>>> deprecated TBH, no functionality replaced it.
>>>
>>> Umm.  Which xref construct did you use that gave this?  The preptool
>>> specification says this:
>>>
>>>
>>>  5.4.8.1.  "derivedContent" Insertion (with Content)
>>>
>>>    For each <xref> element that has content, fill the "derivedContent"
>>>    with the element content, having first trimmed the whitespace from
>>>    ends of content text.  Issue a warning if the "derivedContent"
>>>    attribute already exists and has a different value from what was
>>>    being filled in.
>>>
>>> which xml2rfc is written to implement.  This seems to me to indicate
>>> that it should be possible to explicitly supply, and end up with, just
>>> "Appendix A.".  I've been trying to reproduce what you experienced,
>>> but cannot quite get to the same point.  Could you provide the xml that
>>> gives you for instance "see Section appendix.a Appendix A." ?
>>>
>>>
>>> Best regards,
>>>
>>> 	Henrik
>>>
>>>>
>>>> Thanks,
>>>> Chris.
>>>>
>>>> Henrik Levkowetz <henrik@levkowetz.com> writes:
>>>>
>>>>> Hi Chris,
>>>>>
>>>>> On 2019-02-10 18:34, Christian Hopps wrote:
>>>>>>
>>>>>> I have:
>>>>>>
>>>>>>     see <xref target="org329799d"/>.
>>>>>>     ...<back>...
>>>>>>     <section title="Some Title Text" anchor="org329799d">
>>>>>>
>>>>>> When I run this through xml2rfc (--v3 --text) I get:
>>>>>>
>>>>>>     see Section appendix.a.
>>>>>>     ...
>>>>>>     Appendix A.  Some Title Text
>>>>>>
>>>>>> I would have expected:
>>>>>>
>>>>>>     see Appendix A.
>>>>>>     ...
>>>>>>     Appendix A.  Some Title Text
>>>>>>
>>>>>> Is this a bug?
>>>>>
>>>>> Yes.  Will fix.  Thanks for the report!
>>>>>
>>>>> 	Henrik
>>>>
>>


--=-=-=
Content-Type: application/pgp-signature; name="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCgAdFiEEm56yH/NF+m1FHa6lLh2DDte4MCUFAlxi/QgACgkQLh2DDte4
MCWUxg//fKCbMKo9sHCrADFNez3w4S21ZW0ZMQaoylbO08Gea/T8taCKuQh2R+Ef
KzvBjYJdJkz5P89sDZoKULrfaIaRUjouOU4B7jGqSFVaZsYIzdxDm7MLP/AIMqOI
WXOcUrmLN/s8c3e/Q+j36yjA4A8ETu6adguac2kNgbFQDtRR/aHk19cbMA7lGpmS
F2+R5mgRiGnLAsit/Q1FZ5/Y32yko56BcS2QRs4Nwy2PEOY9RSxSMdpNyBIwzjmU
gfEtY0mDTDREXa+OB3H7kU3DZC7x7mI4CuLer3vZumhqokhbVfDieNohuImdYSSc
QDbU4Hzu2p0jeNEZRF/2JSDKpp3TqtahAX+06YARXGjOp3GNdCIkyL6tJu7sIQ1y
ULNtS+Vgk5wXXUh9UVfGq9VJlRgJL4MA4760GmfS5ircRw6LM1lrmbGs8486WUCt
sdfPYKQjkhD6KcAUhrog/aOOPR+EbJ+KSY4x6fCo9ao+TMf8QwAjY2tmDOAx2zvr
kBSehDS7IE/OmZs5pDS9FEbrST3X7vK1IRQ6gqKYIx1INKsGxCF/dvzGJrzSAWMQ
9H5MHAkKj7uSKmgzLKhaAqljPfPeeDo82YvrTm78jK2ButSORz79CL+V9SZmNhRZ
F+azlMAB/aGbGk42zR+nBINxtDmlvqIpiFxN5AYtnZrMMWVZCeQ=
=eSIA
-----END PGP SIGNATURE-----
--=-=-=--


From nobody Tue Feb 12 13:45:09 2019
Return-Path: <cabo@tzi.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 013C1130DD3 for <xml2rfc@ietfa.amsl.com>; Tue, 12 Feb 2019 13:45:06 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -4.2
X-Spam-Level: 
X-Spam-Status: No, score=-4.2 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_MED=-2.3] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id tV0MO0DkidlW for <xml2rfc@ietfa.amsl.com>; Tue, 12 Feb 2019 13:45:04 -0800 (PST)
Received: from mailhost.informatik.uni-bremen.de (mailhost.informatik.uni-bremen.de [IPv6:2001:638:708:30c9::12]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id AEEF0128B36 for <xml2rfc@ietf.org>; Tue, 12 Feb 2019 13:45:03 -0800 (PST)
X-Virus-Scanned: amavisd-new at informatik.uni-bremen.de
Received: from submithost.informatik.uni-bremen.de (submithost2.informatik.uni-bremen.de [IPv6:2001:638:708:30c8:406a:91ff:fe74:f2b7]) by mailhost.informatik.uni-bremen.de (8.14.5/8.14.5) with ESMTP id x1CLisXJ011829 for <xml2rfc@ietf.org>; Tue, 12 Feb 2019 22:45:00 +0100 (CET)
Received: from [192.168.217.106] (p54A6CC50.dip0.t-ipconnect.de [84.166.204.80]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by submithost.informatik.uni-bremen.de (Postfix) with ESMTPSA id 43zbm65MwKz1Br6; Tue, 12 Feb 2019 22:44:54 +0100 (CET)
From: Carsten Bormann <cabo@tzi.org>
Content-Type: text/plain; charset=utf-8
X-Mao-Original-Outgoing-Id: 571700691.67161-5372efe33021b9594b27a581ddde3704
Content-Transfer-Encoding: quoted-printable
Mime-Version: 1.0 (Mac OS X Mail 11.5 \(3445.9.1\))
Date: Tue, 12 Feb 2019 22:44:53 +0100
Message-Id: <1F333996-79F4-4F3E-B766-9B233726640F@tzi.org>
To: XML2RFC Interest Group <xml2rfc@ietf.org>
X-Mailer: Apple Mail (2.3445.9.1)
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/7wfotp9NeA_tvCSWx9xA8sprjdg>
Subject: [xml2rfc] Core Dump?  Really?
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 12 Feb 2019 21:45:06 -0000

https://travis-ci.org/cbor-wg/cddl/builds/492392314

(A local `make gh-pages` appears to save me.)

Gr=C3=BC=C3=9Fe, Carsten


From nobody Wed Feb 13 02:12:53 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 8A6BB1274D0 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 02:12:51 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id N6KleNy_Jf6D for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 02:12:49 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 48CA212894E for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 02:12:49 -0800 (PST)
Received: from localhost ([::1]:59710 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gtrX4-0005z3-W4; Wed, 13 Feb 2019 02:12:46 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, cabo@tzi.org
X-Trac-Project: xml2rfc
Date: Wed, 13 Feb 2019 10:12:46 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393
Message-ID: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-Trac-Ticket-ID: 393
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, cabo@tzi.org, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/YSArB2OKMXuTqAJhjXJ26kDA2OU>
Subject: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 10:12:52 -0000

#393: Core dump on Travis

 https://travis-ci.org/cbor-wg/cddl/builds

 Build 66 to 70 ended in core dumps.

 {{{
 xml2rfc -q draft-ietf-cbor-cddl.xml -o draft-ietf-cbor-cddl.htmltmp --html
 make: *** [draft-ietf-cbor-cddl.htmltmp] Segmentation fault (core dumped)
 }}}

-- 
---------------------------+----------------------------------
 Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
     Type:  defect         |     Status:  new
 Priority:  blocker        |  Milestone:
Component:  Version 2 cli  |    Version:  2.17.*
 Keywords:                 |
---------------------------+----------------------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb 13 02:27:54 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id B7773124BAA for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 02:27:52 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id Bi-CGzgtkfIv for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 02:27:51 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 0ACDF124408 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 02:27:50 -0800 (PST)
Received: from localhost ([::1]:60211 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gtrle-0004nr-Im; Wed, 13 Feb 2019 02:27:50 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com
X-Trac-Project: xml2rfc
Date: Wed, 13 Feb 2019 10:27:50 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:1
Message-ID: <075.efecc3bf804717dc309a63aa1b4cd0c3@tools.ietf.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-Trac-Ticket-ID: 393
In-Reply-To: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/DQoN9qS02BVOHD_vKGeF4GwXP88>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 10:27:53 -0000

#393: Core dump on Travis


Comment (by henrik@levkowetz.com):

 Good to have the report, but it's doubtful whether it's possible to get
 further without having the dump.

 FWIW, every time I've come across a python program leading to a core dump,
 and been able to trace it down, it's been a problem in a directly or
 indirectly called binary lib, and the remedy has been to avoid the lib
 version that has the problem.  If you're able to get lists of libs on the
 CI system that changed version between the last successful run and the
 failed run, it might tell us something.

-- 
----------------------------+----------------------------------
  Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
      Type:  defect         |     Status:  new
  Priority:  blocker        |  Milestone:
 Component:  Version 2 cli  |    Version:  2.17.*
Resolution:                 |   Keywords:
----------------------------+----------------------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:1>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb 13 02:41:47 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 98DC012894E for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 02:41:45 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id bfdyy6M5Zuj5 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 02:41:43 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 814391274D0 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 02:41:43 -0800 (PST)
Received: from localhost ([::1]:60613 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gtrz4-0007V7-BV; Wed, 13 Feb 2019 02:41:42 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Wed, 13 Feb 2019 10:41:41 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:2
Message-ID: <075.9af44e3fc8043693914e54a2fa9d5e9a@tools.ietf.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-Trac-Ticket-ID: 393
In-Reply-To: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/4ggyISKvU3E8NJ-FQJlLSege_24>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 10:41:46 -0000

#393: Core dump on Travis


Comment (by julian.reschke@gmx.de):

 I have a reproducible crash on Cygwin (quick draft repo):
 {{{
 cat draft-ietf-quic-qpack.md | sed -e 's/{DATE}/2019-02-13/g' | sed -e 's
 /draft-ietf-quic-http-latest/draft-ietf-quic-http/g; s/draft-ietf-quic-
 invariants-latest/draft-ietf-quic-invariants/g; s/draft-ietf-quic-
 recovery-latest/draft-ietf-quic-recovery/g; s/draft-ietf-quic-spin-exp-
 latest/draft-ietf-quic-spin-exp/g; s/draft-ietf-quic-tls-latest/draft-
 ietf-quic-tls/g; s/draft-ietf-quic-transport-latest/draft-ietf-quic-
 transport/g;' | kramdown-rfc2629 > draft-ietf-quic-qpack.xml
 xml2rfc -q draft-ietf-quic-qpack.xml -o draft-ietf-quic-qpack.htmltmp
 --html
 make: *** [lib/main.mk:80: draft-ietf-quic-qpack.htmltmp] Segmentation
 fault (Speicherauszug erstellt)
 rm draft-ietf-quic-qpack.xml
 }}}

-- 
----------------------------+----------------------------------
  Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
      Type:  defect         |     Status:  new
  Priority:  blocker        |  Milestone:
 Component:  Version 2 cli  |    Version:  2.17.*
Resolution:                 |   Keywords:
----------------------------+----------------------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:2>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb 13 02:52:42 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id C8982128B01 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 02:52:40 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id GDW9VgNGg3YC for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 02:52:39 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 1F63812894E for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 02:52:39 -0800 (PST)
Received: from localhost ([::1]:60958 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gts9e-0007q1-Gt; Wed, 13 Feb 2019 02:52:38 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Wed, 13 Feb 2019 10:52:38 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:3
Message-ID: <075.1093f91ab7d3027686ccdf2a024888dd@tools.ietf.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-Trac-Ticket-ID: 393
In-Reply-To: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/IHNIhUACAj8RUHswacVYf-C_ytM>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 10:52:41 -0000

#393: Core dump on Travis


Comment (by henrik@levkowetz.com):

 Still, it's a start.  If it's a full dump in a format that gdb can read,
 it should be helpful, and it might be possible to pinpoint the offending
 binary.

-- 
----------------------------+----------------------------------
  Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
      Type:  defect         |     Status:  new
  Priority:  blocker        |  Milestone:
 Component:  Version 2 cli  |    Version:  2.17.*
Resolution:                 |   Keywords:
----------------------------+----------------------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:3>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb 13 03:20:44 2019
Return-Path: <cabo@tzi.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id A8F46128B01 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 03:20:42 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -4.199
X-Spam-Level: 
X-Spam-Status: No, score=-4.199 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_MED=-2.3, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id FpucmhI1zpJ2 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 03:20:38 -0800 (PST)
Received: from mailhost.informatik.uni-bremen.de (mailhost.informatik.uni-bremen.de [IPv6:2001:638:708:30c9::12]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id CDF791274D0 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 03:20:37 -0800 (PST)
X-Virus-Scanned: amavisd-new at informatik.uni-bremen.de
Received: from submithost.informatik.uni-bremen.de (submithost2.informatik.uni-bremen.de [134.102.200.7]) by mailhost.informatik.uni-bremen.de (8.14.5/8.14.5) with ESMTP id x1DBKR3U010666; Wed, 13 Feb 2019 12:20:32 +0100 (CET)
Received: from sev.informatik.uni-bremen.de (sev.informatik.uni-bremen.de [134.102.218.54]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by submithost.informatik.uni-bremen.de (Postfix) with ESMTPSA id 43zxs70GQlz1Br6; Wed, 13 Feb 2019 12:20:26 +0100 (CET)
Content-Type: text/plain; charset=utf-8
Mime-Version: 1.0 (Mac OS X Mail 11.5 \(3445.9.1\))
From: Carsten Bormann <cabo@tzi.org>
In-Reply-To: <075.efecc3bf804717dc309a63aa1b4cd0c3@tools.ietf.org>
Date: Wed, 13 Feb 2019 12:20:26 +0100
Cc: Henrik Levkowetz <henrik@levkowetz.com>, xml2rfc@ietf.org
X-Mao-Original-Outgoing-Id: 571749624.377188-fa04eddb23f278968fbbaaa31d7e664e
Content-Transfer-Encoding: quoted-printable
Message-Id: <35A81249-8F0C-4A40-A446-81DFA5EB7C26@tzi.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org> <075.efecc3bf804717dc309a63aa1b4cd0c3@tools.ietf.org>
To: xml2rfc issue tracker <trac@tools.ietf.org>
X-Mailer: Apple Mail (2.3445.9.1)
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/3SKZSNMql-x0-JJx5pS1En17NjU>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 11:20:43 -0000

On Feb 13, 2019, at 11:27, xml2rfc issue tracker <trac@tools.ietf.org> =
wrote:
>=20
> #393: Core dump on Travis
>=20
>=20
> Comment (by henrik@levkowetz.com):
>=20
> Good to have the report, but it's doubtful whether it's possible to =
get
> further without having the dump.

Right.  I was wondering how to get the I-D makefile/template to save the =
core=E2=80=A6
Maybe we=E2=80=99ll need to construct a leaner test case.

> FWIW, every time I've come across a python program leading to a core =
dump,
> and been able to trace it down, it's been a problem in a directly or
> indirectly called binary lib, and the remedy has been to avoid the lib
> version that has the problem. =20

Right.  The libs are visible in the build log:

{{{
Collecting xml2rfc
  Downloading =
https://files.pythonhosted.org/packages/94/11/991783a57d55c1c462ff82a59143=
b940b3dbde3f9a44a940f5f93edea880/xml2rfc-2.18.0.tar.gz (3.6MB)
Collecting google-i18n-address>=3D2.3.2 (from xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/3a/a8/ab3b57025039480a739e348b088b=
89e897c08babf3644bc31497dbc49103/google_i18n_address-2.3.4-py2.py3-none-an=
y.whl (772kB)
Collecting html5lib>=3D1.0.1 (from xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/a5/62/bbd2be0e7943ec8504b517e62bab=
011b4946e1258842bc159e5dfde15b96/html5lib-1.0.1-py2.py3-none-any.whl =
(117kB)
Collecting intervaltree!=3D3.0.0,>=3D2.1.0 (from xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/e8/f9/76237755b2020cd74549e9866721=
0b2dd54d3fb17c6f4a62631e61d31225/intervaltree-3.0.2.tar.gz
Collecting lxml>=3D2.2.8 (from xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/79/85/121bd54a83d0183c7ccbb8f827f5=
e96fb38c0066f2440782f638367db4b8/lxml-4.3.1-cp27-cp27mu-manylinux1_x86_64.=
whl (5.6MB)
Collecting pycountry>=3D1.8 (from xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/f8/39/04d8215fddd5b263beb36cc324e5=
656714a19081cacb2fc7c8e6afc2817d/pycountry-18.12.8-py2.py3-none-any.whl =
(10.5MB)
Collecting pyflakes>=3D0.8.1 (from xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/16/3b/b6a508ad148ce1ef50bd7a9a783a=
fbb8d775616fc4ae5e3007c8815a3c85/pyflakes-2.1.0-py2.py3-none-any.whl =
(62kB)
Collecting requests>=3D2.5.0 (from xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/7d/e3/20f3d364d6c8e5d2353c72a67778=
eb189176f08e873c9900e10c0287b84b/requests-2.21.0-py2.py3-none-any.whl =
(57kB)
Requirement already satisfied: setuptools>=3D18.0 in =
/home/travis/virtualenv/python2.7.14/lib/python2.7/site-packages (from =
xml2rfc)
Requirement already satisfied: six>=3D1.4.1 in =
/home/travis/virtualenv/python2.7.14/lib/python2.7/site-packages (from =
xml2rfc)
Collecting webencodings (from html5lib>=3D1.0.1->xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/f4/24/2a3e3df732393fed8b3ebf2ec078=
f05546de641fe1b667ee316ec1dcf3b7/webencodings-0.5.1-py2.py3-none-any.whl
Collecting sortedcontainers<3.0,>=3D2.0 (from =
intervaltree!=3D3.0.0,>=3D2.1.0->xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/13/f3/cf85f7c3a2dbd1a515d51e1f1676=
d971abe41bba6f4ab5443240d9a78e5b/sortedcontainers-2.1.0-py2.py3-none-any.w=
hl
Collecting certifi>=3D2017.4.17 (from requests>=3D2.5.0->xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/9f/e0/accfc1b56b57e9750eba272e24c4=
dddeac86852c2bebd1236674d7887e8a/certifi-2018.11.29-py2.py3-none-any.whl =
(154kB)
Collecting chardet<3.1.0,>=3D3.0.2 (from requests>=3D2.5.0->xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/bc/a9/01ffebfb562e4274b6487b4bb1dd=
ec7ca55ec7510b22e4c51f14098443b8/chardet-3.0.4-py2.py3-none-any.whl =
(133kB)
Collecting idna<2.9,>=3D2.5 (from requests>=3D2.5.0->xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/14/2c/cd551d81dbe15200be1cf41cd038=
69a46fe7226e7450af7a6545bfc474c9/idna-2.8-py2.py3-none-any.whl (58kB)
Collecting urllib3<1.25,>=3D1.21.1 (from requests>=3D2.5.0->xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/62/00/ee1d7de624db8ba7090d1226aebe=
fab96a2c71cd5cfa7629d6ad3f61b79e/urllib3-1.24.1-py2.py3-none-any.whl =
(118kB)
Building wheels for collected packages: xml2rfc, intervaltree
  Running setup.py bdist_wheel for xml2rfc: started
  Running setup.py bdist_wheel for xml2rfc: finished with status 'done'
  Stored in directory: =
/home/travis/.cache/pip/wheels/c5/86/11/481dd67b334f4398cfd672c588091cda56=
1677f91f09e2238a
  Running setup.py bdist_wheel for intervaltree: started
  Running setup.py bdist_wheel for intervaltree: finished with status =
'done'
  Stored in directory: =
/home/travis/.cache/pip/wheels/08/99/c0/5a5942f5b9567c59c14aac76f95a70bf11=
dccc71240b91ebf5
Successfully built xml2rfc intervaltree
Installing collected packages: certifi, chardet, idna, urllib3, =
requests, google-i18n-address, webencodings, html5lib, sortedcontainers, =
intervaltree, lxml, pycountry, pyflakes, xml2rfc
Successfully installed certifi-2018.11.29 chardet-3.0.4 =
google-i18n-address-2.3.4 html5lib-1.0.1 idna-2.8 intervaltree-3.0.2 =
lxml-4.3.1 pycountry-18.12.8 pyflakes-2.1.0 requests-2.21.0 =
sortedcontainers-2.1.0 urllib3-1.24.1 webencodings-0.5.1 xml2rfc-2.18.0
}}}


> If you're able to get lists of libs on the
> CI system that changed version between the last successful run and the
> failed run, it might tell us something.

I don=E2=80=99t have a good set of specimens, but e.g. =
https://travis-ci.org/core-wg/senml-etch/builds/492386161 went through =
just 14 hours ago and used this set:

{{{
Collecting xml2rfc
  Downloading =
https://files.pythonhosted.org/packages/94/11/991783a57d55c1c462ff82a59143=
b940b3dbde3f9a44a940f5f93edea880/xml2rfc-2.18.0.tar.gz (3.6MB)
Collecting google-i18n-address>=3D2.3.2 (from xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/3a/a8/ab3b57025039480a739e348b088b=
89e897c08babf3644bc31497dbc49103/google_i18n_address-2.3.4-py2.py3-none-an=
y.whl (772kB)
Collecting html5lib>=3D1.0.1 (from xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/a5/62/bbd2be0e7943ec8504b517e62bab=
011b4946e1258842bc159e5dfde15b96/html5lib-1.0.1-py2.py3-none-any.whl =
(117kB)
Collecting intervaltree!=3D3.0.0,>=3D2.1.0 (from xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/e8/f9/76237755b2020cd74549e9866721=
0b2dd54d3fb17c6f4a62631e61d31225/intervaltree-3.0.2.tar.gz
Collecting lxml>=3D2.2.8 (from xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/79/85/121bd54a83d0183c7ccbb8f827f5=
e96fb38c0066f2440782f638367db4b8/lxml-4.3.1-cp27-cp27mu-manylinux1_x86_64.=
whl (5.6MB)
Collecting pycountry>=3D1.8 (from xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/f8/39/04d8215fddd5b263beb36cc324e5=
656714a19081cacb2fc7c8e6afc2817d/pycountry-18.12.8-py2.py3-none-any.whl =
(10.5MB)
Collecting pyflakes>=3D0.8.1 (from xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/16/3b/b6a508ad148ce1ef50bd7a9a783a=
fbb8d775616fc4ae5e3007c8815a3c85/pyflakes-2.1.0-py2.py3-none-any.whl =
(62kB)
Collecting requests>=3D2.5.0 (from xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/7d/e3/20f3d364d6c8e5d2353c72a67778=
eb189176f08e873c9900e10c0287b84b/requests-2.21.0-py2.py3-none-any.whl =
(57kB)
Requirement already satisfied: setuptools>=3D18.0 in =
/home/travis/virtualenv/python2.7.15/lib/python2.7/site-packages (from =
xml2rfc) (40.6.3)
Requirement already satisfied: six>=3D1.4.1 in =
/home/travis/virtualenv/python2.7.15/lib/python2.7/site-packages (from =
xml2rfc) (1.11.0)
Collecting webencodings (from html5lib>=3D1.0.1->xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/f4/24/2a3e3df732393fed8b3ebf2ec078=
f05546de641fe1b667ee316ec1dcf3b7/webencodings-0.5.1-py2.py3-none-any.whl
Collecting sortedcontainers<3.0,>=3D2.0 (from =
intervaltree!=3D3.0.0,>=3D2.1.0->xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/13/f3/cf85f7c3a2dbd1a515d51e1f1676=
d971abe41bba6f4ab5443240d9a78e5b/sortedcontainers-2.1.0-py2.py3-none-any.w=
hl
Collecting urllib3<1.25,>=3D1.21.1 (from requests>=3D2.5.0->xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/62/00/ee1d7de624db8ba7090d1226aebe=
fab96a2c71cd5cfa7629d6ad3f61b79e/urllib3-1.24.1-py2.py3-none-any.whl =
(118kB)
Collecting chardet<3.1.0,>=3D3.0.2 (from requests>=3D2.5.0->xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/bc/a9/01ffebfb562e4274b6487b4bb1dd=
ec7ca55ec7510b22e4c51f14098443b8/chardet-3.0.4-py2.py3-none-any.whl =
(133kB)
Collecting idna<2.9,>=3D2.5 (from requests>=3D2.5.0->xml2rfc)
  Downloading =
https://files.pythonhosted.org/packages/14/2c/cd551d81dbe15200be1cf41cd038=
69a46fe7226e7450af7a6545bfc474c9/idna-2.8-py2.py3-none-any.whl (58kB)
Requirement already satisfied: certifi>=3D2017.4.17 in =
/home/travis/virtualenv/python2.7.15/lib/python2.7/site-packages (from =
requests>=3D2.5.0->xml2rfc) (2018.10.15)
Building wheels for collected packages: xml2rfc, intervaltree
  Running setup.py bdist_wheel for xml2rfc: started
  Running setup.py bdist_wheel for xml2rfc: finished with status 'done'
  Stored in directory: =
/home/travis/.cache/pip/wheels/c5/86/11/481dd67b334f4398cfd672c588091cda56=
1677f91f09e2238a
  Running setup.py bdist_wheel for intervaltree: started
  Running setup.py bdist_wheel for intervaltree: finished with status =
'done'
  Stored in directory: =
/home/travis/.cache/pip/wheels/08/99/c0/5a5942f5b9567c59c14aac76f95a70bf11=
dccc71240b91ebf5
Successfully built xml2rfc intervaltree
Installing collected packages: urllib3, chardet, idna, requests, =
google-i18n-address, webencodings, html5lib, sortedcontainers, =
intervaltree, lxml, pycountry, pyflakes, xml2rfc
Successfully installed chardet-3.0.4 google-i18n-address-2.3.4 =
html5lib-1.0.1 idna-2.8 intervaltree-3.0.2 lxml-4.3.1 pycountry-18.12.8 =
pyflakes-2.1.0 requests-2.21.0 sortedcontainers-2.1.0 urllib3-1.24.1 =
webencodings-0.5.1 xml2rfc-2.18.0
}}}

The main difference I see is python 2.7.15 in the one that worked and =
2.7.14 in the one that crashed, and the unbundling of certifi.

Gr=C3=BC=C3=9Fe, Carsten

>=20
> --=20
> ----------------------------+----------------------------------
>  Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
>      Type:  defect         |     Status:  new
>  Priority:  blocker        |  Milestone:
> Component:  Version 2 cli  |    Version:  2.17.*
> Resolution:                 |   Keywords:
> ----------------------------+----------------------------------
>=20
> Ticket URL: =
<https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:1>
> xml2rfc <http://tools.ietf.org/tools/xml2rfc/>
>=20
> _______________________________________________
> xml2rfc mailing list
> xml2rfc@ietf.org
> https://www.ietf.org/mailman/listinfo/xml2rfc
>=20


From nobody Wed Feb 13 03:25:51 2019
Return-Path: <cabo@tzi.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 7BC1913103B for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 03:25:35 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -4.2
X-Spam-Level: 
X-Spam-Status: No, score=-4.2 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_MED=-2.3] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id JHB8Tp-HNGFq for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 03:25:33 -0800 (PST)
Received: from mailhost.informatik.uni-bremen.de (mailhost.informatik.uni-bremen.de [IPv6:2001:638:708:30c9::12]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 6982B130E74 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 03:25:33 -0800 (PST)
X-Virus-Scanned: amavisd-new at informatik.uni-bremen.de
Received: from submithost.informatik.uni-bremen.de (submithost2.informatik.uni-bremen.de [IPv6:2001:638:708:30c8:406a:91ff:fe74:f2b7]) by mailhost.informatik.uni-bremen.de (8.14.5/8.14.5) with ESMTP id x1DBPOGX013349; Wed, 13 Feb 2019 12:25:29 +0100 (CET)
Received: from sev.informatik.uni-bremen.de (sev.informatik.uni-bremen.de [134.102.218.54]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by submithost.informatik.uni-bremen.de (Postfix) with ESMTPSA id 43zxyr3wlPz1Br6; Wed, 13 Feb 2019 12:25:24 +0100 (CET)
Content-Type: text/plain; charset=utf-8
Mime-Version: 1.0 (Mac OS X Mail 11.5 \(3445.9.1\))
From: Carsten Bormann <cabo@tzi.org>
In-Reply-To: <35A81249-8F0C-4A40-A446-81DFA5EB7C26@tzi.org>
Date: Wed, 13 Feb 2019 12:25:23 +0100
Cc: Henrik Levkowetz <henrik@levkowetz.com>, xml2rfc@ietf.org
X-Mao-Original-Outgoing-Id: 571749921.8723021-e8862d4de510d2c0f9757ad7554c980a
Content-Transfer-Encoding: quoted-printable
Message-Id: <4291267A-2240-4BEC-A7E5-E6F89C9D55A7@tzi.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org> <075.efecc3bf804717dc309a63aa1b4cd0c3@tools.ietf.org> <35A81249-8F0C-4A40-A446-81DFA5EB7C26@tzi.org>
To: xml2rfc issue tracker <trac@tools.ietf.org>
X-Mailer: Apple Mail (2.3445.9.1)
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/rIqFfrwCesiEA6YsYwkf1C0NIJA>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 11:25:49 -0000

Hmm, Ari (whose build works) is using xenial (Ubuntu 16) in his =
.travis.yml, while I=E2=80=99m still using trusty (Ubuntu 14).  =
Upgrading .travis.yml now=E2=80=A6

Gr=C3=BC=C3=9Fe, Carsten


From nobody Wed Feb 13 03:32:18 2019
Return-Path: <cabo@tzi.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 27609130DE7 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 03:32:17 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -4.199
X-Spam-Level: 
X-Spam-Status: No, score=-4.199 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_MED=-2.3, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 7d9gl05Gpjx9 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 03:32:15 -0800 (PST)
Received: from mailhost.informatik.uni-bremen.de (mailhost.informatik.uni-bremen.de [IPv6:2001:638:708:30c9::12]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 0657F128CB7 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 03:32:14 -0800 (PST)
X-Virus-Scanned: amavisd-new at informatik.uni-bremen.de
Received: from submithost.informatik.uni-bremen.de (submithost2.informatik.uni-bremen.de [IPv6:2001:638:708:30c8:406a:91ff:fe74:f2b7]) by mailhost.informatik.uni-bremen.de (8.14.5/8.14.5) with ESMTP id x1DBVYqY019070; Wed, 13 Feb 2019 12:31:40 +0100 (CET)
Received: from sev.informatik.uni-bremen.de (sev.informatik.uni-bremen.de [134.102.218.54]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by submithost.informatik.uni-bremen.de (Postfix) with ESMTPSA id 43zy5y668Wz1Br6; Wed, 13 Feb 2019 12:31:34 +0100 (CET)
Content-Type: text/plain; charset=utf-8
Mime-Version: 1.0 (Mac OS X Mail 11.5 \(3445.9.1\))
From: Carsten Bormann <cabo@tzi.org>
In-Reply-To: <4291267A-2240-4BEC-A7E5-E6F89C9D55A7@tzi.org>
Date: Wed, 13 Feb 2019 12:31:34 +0100
Cc: xml2rfc@ietf.org
X-Mao-Original-Outgoing-Id: 571750292.298785-b76fd88b4a7befcf2a6b943af1138386
Content-Transfer-Encoding: quoted-printable
Message-Id: <EF12098D-648C-46C3-981F-3371FAAFAEA7@tzi.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org> <075.efecc3bf804717dc309a63aa1b4cd0c3@tools.ietf.org> <35A81249-8F0C-4A40-A446-81DFA5EB7C26@tzi.org> <4291267A-2240-4BEC-A7E5-E6F89C9D55A7@tzi.org>
To: xml2rfc issue tracker <trac@tools.ietf.org>
X-Mailer: Apple Mail (2.3445.9.1)
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/dzPyMOIk_GcWAAtW4tLjHg-stA8>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 11:32:17 -0000

On Feb 13, 2019, at 12:25, Carsten Bormann <cabo@tzi.org> wrote:
>=20
> Hmm, Ari (whose build works) is using xenial (Ubuntu 16) in his =
.travis.yml, while I=E2=80=99m still using trusty (Ubuntu 14). Upgrading =
.travis.yml now=E2=80=A6

That was not it.

https://travis-ci.org/cbor-wg/cddl/builds/492649664

Gr=C3=BC=C3=9Fe, Carsten


From nobody Wed Feb 13 03:44:54 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 87A4F130E25 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 03:44:53 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id qzgRpzBKGX-V for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 03:44:51 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id CA674130DE7 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 03:44:51 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:65517 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gtsyB-0004hI-8U; Wed, 13 Feb 2019 03:44:51 -0800
To: Carsten Bormann <cabo@tzi.org>, xml2rfc issue tracker <trac@tools.ietf.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org> <075.efecc3bf804717dc309a63aa1b4cd0c3@tools.ietf.org> <35A81249-8F0C-4A40-A446-81DFA5EB7C26@tzi.org>
Cc: xml2rfc@ietf.org
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <cd90e84e-34aa-49b1-24b9-3e12a6aacff2@levkowetz.com>
Date: Wed, 13 Feb 2019 12:44:43 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <35A81249-8F0C-4A40-A446-81DFA5EB7C26@tzi.org>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="W77wLIbQRAguXbfpKJfapG1Us7DUMk3bm"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, trac@tools.ietf.org, cabo@tzi.org
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/7tVf7S0G1abrtKmDX6_k5gZEV84>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 11:44:54 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--W77wLIbQRAguXbfpKJfapG1Us7DUMk3bm
Content-Type: multipart/mixed; boundary="E9dsiG6R1i1H3nuA47E6lEWBD7M1eFKjx";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Carsten Bormann <cabo@tzi.org>,
 xml2rfc issue tracker <trac@tools.ietf.org>
Cc: xml2rfc@ietf.org
Message-ID: <cd90e84e-34aa-49b1-24b9-3e12a6aacff2@levkowetz.com>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
 <075.efecc3bf804717dc309a63aa1b4cd0c3@tools.ietf.org>
 <35A81249-8F0C-4A40-A446-81DFA5EB7C26@tzi.org>
In-Reply-To: <35A81249-8F0C-4A40-A446-81DFA5EB7C26@tzi.org>

--E9dsiG6R1i1H3nuA47E6lEWBD7M1eFKjx
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable



On 2019-02-13 12:20, Carsten Bormann wrote:
> The main difference I see is python 2.7.15 in the one that worked and
> 2.7.14 in the one that crashed, and the unbundling of certifi.

Both those seem like possibles, although the level of testing a Python
release goes through make me suspect certifi more.

I'll upgrade python here and see if that lets me reproduce this.


	Henrik


--E9dsiG6R1i1H3nuA47E6lEWBD7M1eFKjx--

--W77wLIbQRAguXbfpKJfapG1Us7DUMk3bm
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxkAysACgkQTptXS4+7
FxpA3xAAqQGjWLG/RzM0foxqflXZgUeU0d2mcYqud+MPSuMVG2zCscmruNhcTgJw
PXbMWB19qVMyjXIFvdxfGU8GnU3oBGDyChX+ge6ajAxl9wuRtFFdvz7PCQiM9bkQ
RuCuYp/6Ov8W20aGNtutvXpVzB5nEoGD5LDYpVAJPjihKftd5Qvc+3Rbax8QtFw8
8hn9QYCWclup6LmqYxmeNU/B94kJgxDF04/W3ioWeAZXP9pMqWSCpN8LPFVHmEHv
QwbcfllauSm9ASFWlBtGoVNtq0E+kUqzVfXJkCMqfnBTUhEMgGH248pZqaUMF02d
82mdez2Q3sClvCWSEXEIGkq63M1M9tqfPBt46OjrDexsZjJCUwRVQU32cL5B1ZKy
+i0N3HonF+ROmft4lQH+l04SvM9qXbfBummU+FHsSCdyx1K+qtiJaNBlQ//CMpn8
XWHF66/i2AUYEW8kMKEOEOZHZ/fDbcqXxsCwpzuu83qeKUdxFO83HZlgdmEVQiqI
ULqE0NjRvqCe4+NgT1m3FH5fFuhwrDeOLGgk26DO9hrZCXYF1ErbB8otYmpOWrxi
dvmuwmpijlcrN7JNiKVMz76mfY48fLMfbEq/KcNGC4SeHsD5i49LpmsmG1Tn4ayQ
LwKewB/UkfrZ2E2sy4TdcNNRfElYyLP3L8tnPPQCXyE/SVxPngM=
=0L+e
-----END PGP SIGNATURE-----

--W77wLIbQRAguXbfpKJfapG1Us7DUMk3bm--


From nobody Wed Feb 13 04:14:22 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id CA86A128CB7 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 04:14:20 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id NBn9ihHPT-47 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 04:14:18 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 41986128AFB for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 04:14:16 -0800 (PST)
Received: from localhost ([::1]:34836 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gttQd-000170-H4; Wed, 13 Feb 2019 04:14:15 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Wed, 13 Feb 2019 12:14:15 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:4
Message-ID: <075.9ee211ec3e6bfea5d52f18b099de2fe5@tools.ietf.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-Trac-Ticket-ID: 393
In-Reply-To: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/dQDppSvWNDlZX3qmDKYnR4jpIZA>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 12:14:21 -0000

#393: Core dump on Travis


Comment (by julian.reschke@gmx.de):

 I don't see anything except the dump I inlined above.

-- 
----------------------------+----------------------------------
  Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
      Type:  defect         |     Status:  new
  Priority:  blocker        |  Milestone:
 Component:  Version 2 cli  |    Version:  2.17.*
Resolution:                 |   Keywords:
----------------------------+----------------------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:4>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb 13 04:19:46 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 63743128CE4 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 04:19:44 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id yxcnOtqUjl_l for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 04:19:43 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 04A83128CB7 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 04:19:43 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:49621 helo=tannat.localdomain) by durif.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gttVi-0002g9-Jp; Wed, 13 Feb 2019 04:19:39 -0800
To: xml2rfc issue tracker <trac@tools.ietf.org>, julian.reschke@gmx.de
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org> <075.9ee211ec3e6bfea5d52f18b099de2fe5@tools.ietf.org>
Cc: xml2rfc@ietf.org
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <d69e2b39-e8eb-e2da-25cf-fd94c6e6d937@levkowetz.com>
Date: Wed, 13 Feb 2019 13:19:22 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <075.9ee211ec3e6bfea5d52f18b099de2fe5@tools.ietf.org>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="OJra7gr5tVIxCdH45CAtQgEcjUut5uCef"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, julian.reschke@gmx.de, trac@tools.ietf.org
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on durif.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/hZxu-pwQScOXNlEmOvzgDOPFrCE>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 12:19:44 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--OJra7gr5tVIxCdH45CAtQgEcjUut5uCef
Content-Type: multipart/mixed; boundary="GOWUl3l5CGr4uvr2tuol0GHV9JIHsgL9F";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: xml2rfc issue tracker <trac@tools.ietf.org>, julian.reschke@gmx.de
Cc: xml2rfc@ietf.org
Message-ID: <d69e2b39-e8eb-e2da-25cf-fd94c6e6d937@levkowetz.com>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
 <075.9ee211ec3e6bfea5d52f18b099de2fe5@tools.ietf.org>
In-Reply-To: <075.9ee211ec3e6bfea5d52f18b099de2fe5@tools.ietf.org>

--GOWUl3l5CGr4uvr2tuol0GHV9JIHsgL9F
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable

Ok, thanks.

	Henrik

On 2019-02-13 13:14, xml2rfc issue tracker wrote:
> #393: Core dump on Travis
>=20
>=20
> Comment (by julian.reschke@gmx.de):
>=20
>  I don't see anything except the dump I inlined above.
>=20


--GOWUl3l5CGr4uvr2tuol0GHV9JIHsgL9F--

--OJra7gr5tVIxCdH45CAtQgEcjUut5uCef
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxkC0oACgkQTptXS4+7
FxqWxxAAr+8sUhF3o59KDh1cCPh9BRP4pMSqZ0TJD1YkfVSrHg8UBDqH1/GyPxkk
Fc5szrc/uM3iCHkQc9yRR0EXLmT7T8rZ0mPyEf7VJktR6PqhYS4x67z9NfA15NRO
nMzCdzRBjd5iQPuQ/fWLs49UD7tzVZ6PjUnO6tGstHoPKVTLcrwT/iXbtQOwfalp
swVK6KsgooHErBOGKYWbmrWVKhCtYCUY6vyOvGKR8xs6Rsn2Zdni/M/j+C8JskvC
zoKs+7Dl23mBD+RUTafDV/GC6dP/pSQldc5ciJ3NKgFnOYVQkpaqv2YBrDuYlX2/
YZP74DrJPfibOuY/s/1t9aKpcDd/Cw6swTQspEqxHK9KQ7NYVANN38MCzGO+UwWH
M/St90cKq2K36GEtpvffMcou2IvAKpnLzCZasbTxypowbjQdCKbIW3XRGs+OYR+c
SpiB/3Q8jeatx5edW998k8K8R9JTFs9s26E/zw2suByMiYowVbok7OyF27dUqWnG
Ka2lAcmWooK7YaOqPRqhodfIF4Fhse7Lm1Ql3vBheqPKD2pIHqTURg4qf7QSZ9Yg
G8Z+SHpMeJJv6hKtHgfKffTPqMZwvKDqpCAqYfiQVVKZ8+qx5DhSupTFLMKXkoJJ
6Y41NVkjuUvRRsudw6jMpf7hrUXF7lK6u+AM3qfh45NXbgjxgvk=
=k+Tf
-----END PGP SIGNATURE-----

--OJra7gr5tVIxCdH45CAtQgEcjUut5uCef--


From nobody Wed Feb 13 05:30:31 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 1BDB3128BCC for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 05:30:31 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id IQ0OF0Reo64e for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 05:30:29 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 22F45128CE4 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 05:30:29 -0800 (PST)
Received: from localhost ([::1]:36863 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gtucO-0003CY-36; Wed, 13 Feb 2019 05:30:28 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Wed, 13 Feb 2019 13:30:28 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:5
Message-ID: <075.6aab9e971a2c4ad0d9baebdd2763191d@tools.ietf.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-Trac-Ticket-ID: 393
In-Reply-To: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/grl-iuXemEDjjHmQGdaJrRowh74>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 13:30:31 -0000

#393: Core dump on Travis


Comment (by henrik@levkowetz.com):

 Thanks.  Using that with python 2.7.13 works fine.

 I've just built Python 2.7.15 from source, and using that I get a
 segmentation fault here.

 Can you tell the CI framework to avoid Python 2.7.15?

-- 
----------------------------+----------------------------------
  Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
      Type:  defect         |     Status:  new
  Priority:  blocker        |  Milestone:
 Component:  Version 2 cli  |    Version:  2.17.*
Resolution:                 |   Keywords:
----------------------------+----------------------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:5>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb 13 05:35:37 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 3F4C1128CE4 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 05:35:35 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id Hg5K8YxJfxme for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 05:35:33 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 4B3B2128BCC for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 05:35:33 -0800 (PST)
Received: from localhost ([::1]:37012 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gtuhI-0006eV-NX; Wed, 13 Feb 2019 05:35:32 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Wed, 13 Feb 2019 13:35:32 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:6
Message-ID: <075.75be865aed15d765aca80b195ae67110@tools.ietf.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-Trac-Ticket-ID: 393
In-Reply-To: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/NPi4A8_NMfoPOkqZR0Bc6-oHcXo>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 13:35:36 -0000

#393: Core dump on Travis


Comment (by julian.reschke@gmx.de):

 FWIW, I'm on 2.7.14.

-- 
----------------------------+----------------------------------
  Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
      Type:  defect         |     Status:  new
  Priority:  blocker        |  Milestone:
 Component:  Version 2 cli  |    Version:  2.17.*
Resolution:                 |   Keywords:
----------------------------+----------------------------------

Ticket URL: <https://tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:6>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb 13 05:39:11 2019
Return-Path: <cabo@tzi.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 4A33E128CE4 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 05:39:09 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -4.2
X-Spam-Level: 
X-Spam-Status: No, score=-4.2 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_MED=-2.3] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id RJo1-ooJnVBe for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 05:39:07 -0800 (PST)
Received: from mailhost.informatik.uni-bremen.de (mailhost.informatik.uni-bremen.de [IPv6:2001:638:708:30c9::12]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id E2D60128BCC for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 05:39:06 -0800 (PST)
X-Virus-Scanned: amavisd-new at informatik.uni-bremen.de
Received: from submithost.informatik.uni-bremen.de (submithost2.informatik.uni-bremen.de [IPv6:2001:638:708:30c8:406a:91ff:fe74:f2b7]) by mailhost.informatik.uni-bremen.de (8.14.5/8.14.5) with ESMTP id x1DDcvGY026344; Wed, 13 Feb 2019 14:39:02 +0100 (CET)
Received: from sev.informatik.uni-bremen.de (sev.informatik.uni-bremen.de [134.102.218.54]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by submithost.informatik.uni-bremen.de (Postfix) with ESMTPSA id 4400wx6czVz1Br6; Wed, 13 Feb 2019 14:38:57 +0100 (CET)
Content-Type: text/plain; charset=utf-8
Mime-Version: 1.0 (Mac OS X Mail 11.5 \(3445.9.1\))
From: Carsten Bormann <cabo@tzi.org>
In-Reply-To: <075.75be865aed15d765aca80b195ae67110@tools.ietf.org>
Date: Wed, 13 Feb 2019 14:38:57 +0100
Cc: Henrik Levkowetz <henrik@levkowetz.com>, julian.reschke@gmx.de, xml2rfc@ietf.org
X-Mao-Original-Outgoing-Id: 571757935.4584219-c4a4859c880dcc14ca147560a6f6dc4a
Content-Transfer-Encoding: quoted-printable
Message-Id: <12ED2B61-4456-48E7-8396-1303A494A0A4@tzi.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org> <075.75be865aed15d765aca80b195ae67110@tools.ietf.org>
To: xml2rfc issue tracker <trac@tools.ietf.org>
X-Mailer: Apple Mail (2.3445.9.1)
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/XdT8i9RbIIQa0nDiORfHM--WzQ4>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 13:39:09 -0000

FWIW, 2.7.15 works for me on my Mac (10.13.6).
(I=E2=80=99m normally using Python 3.)

Gr=C3=BC=C3=9Fe, Carsten


From nobody Wed Feb 13 05:40:13 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 3E0DE12D826 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 05:40:12 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id Y_IQiROqoK9v for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 05:40:10 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 19001128CE4 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 05:40:04 -0800 (PST)
Received: from localhost ([::1]:37195 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gtulf-0000HP-IN; Wed, 13 Feb 2019 05:40:03 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Wed, 13 Feb 2019 13:40:02 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:7
Message-ID: <075.2313c628240364e421aaed23d70574c5@tools.ietf.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-Trac-Ticket-ID: 393
In-Reply-To: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/l305Fk6JUVI2zqn7YFX4sqShL8o>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 13:40:12 -0000

#393: Core dump on Travis


Comment (by henrik@levkowetz.com):

 I've just generated a core dump from the segmentation fault, and it turns
 out that although it's triggered under Python 2.7.15, the segmentation
 fault is in the lxml 'etree.so' lib; so not the Python executable itself.
 Avoiding Python 2.7.14 and 2.7.15 for now if possible should still let you
 get past this.

 I'll spend some time later this week to see if this is triggered only for
 particular versions of lxml (I'm on lxml 4.3.1 here when this is
 triggered).

-- 
----------------------------+----------------------------------
  Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
      Type:  defect         |     Status:  new
  Priority:  blocker        |  Milestone:
 Component:  Version 2 cli  |    Version:  2.17.*
Resolution:                 |   Keywords:
----------------------------+----------------------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:7>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb 13 05:41:47 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 1076312D826 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 05:41:45 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id cIC2PztpLcXf for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 05:41:43 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 03D06128CE4 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 05:41:43 -0800 (PST)
Received: from localhost ([::1]:37250 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gtunG-0000aq-DH; Wed, 13 Feb 2019 05:41:42 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Wed, 13 Feb 2019 13:41:42 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:8
Message-ID: <075.7d9125b199f88b69062f31306eae1c73@tools.ietf.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-Trac-Ticket-ID: 393
In-Reply-To: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/L0jwzFoeDRYf6xjs5_C1GVqVi4o>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 13:41:45 -0000

#393: Core dump on Travis


Comment (by julian.reschke@gmx.de):

 That reminds me that I just recently updated lxml, as xml2rfc politely
 asked me to do so (WRT XPATH locations in validation errors). So this is
 probably the reason why I started to see these.

-- 
----------------------------+----------------------------------
  Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
      Type:  defect         |     Status:  new
  Priority:  blocker        |  Milestone:
 Component:  Version 2 cli  |    Version:  2.17.*
Resolution:                 |   Keywords:
----------------------------+----------------------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:8>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb 13 05:58:50 2019
Return-Path: <cabo@tzi.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 7A90012D826 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 05:58:49 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -4.199
X-Spam-Level: 
X-Spam-Status: No, score=-4.199 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_MED=-2.3, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id rARxx7qGbbb2 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 05:58:47 -0800 (PST)
Received: from mailhost.informatik.uni-bremen.de (mailhost.informatik.uni-bremen.de [IPv6:2001:638:708:30c9::12]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 434331274D0 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 05:58:47 -0800 (PST)
X-Virus-Scanned: amavisd-new at informatik.uni-bremen.de
Received: from submithost.informatik.uni-bremen.de (submithost2.informatik.uni-bremen.de [IPv6:2001:638:708:30c8:406a:91ff:fe74:f2b7]) by mailhost.informatik.uni-bremen.de (8.14.5/8.14.5) with ESMTP id x1DDwbbc011029; Wed, 13 Feb 2019 14:58:42 +0100 (CET)
Received: from sev.informatik.uni-bremen.de (sev.informatik.uni-bremen.de [134.102.218.54]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by submithost.informatik.uni-bremen.de (Postfix) with ESMTPSA id 4401Mc6sqvz1Br6; Wed, 13 Feb 2019 14:58:36 +0100 (CET)
Content-Type: text/plain; charset=utf-8
Mime-Version: 1.0 (Mac OS X Mail 11.5 \(3445.9.1\))
From: Carsten Bormann <cabo@tzi.org>
In-Reply-To: <075.2313c628240364e421aaed23d70574c5@tools.ietf.org>
Date: Wed, 13 Feb 2019 14:58:35 +0100
Cc: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-Mao-Original-Outgoing-Id: 571759113.765187-400f7d47ed35b0505c40701852bc6266
Content-Transfer-Encoding: quoted-printable
Message-Id: <8E9B5E78-9E89-4AEB-8CD3-5D52FDDB543D@tzi.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org> <075.2313c628240364e421aaed23d70574c5@tools.ietf.org>
To: xml2rfc issue tracker <trac@tools.ietf.org>
X-Mailer: Apple Mail (2.3445.9.1)
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/84kI_8qkuGRS1p_Oh4Wh3W0hrzY>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 13:58:50 -0000

On Feb 13, 2019, at 14:40, xml2rfc issue tracker <trac@tools.ietf.org> =
wrote:
>=20
> Avoiding Python 2.7.14 and 2.7.15 for now if possible should still let =
you
> get past this.

Just tried Python 3.7.1.  Core dump.

https://travis-ci.org/cbor-wg/cddl/builds/492709063

Gr=C3=BC=C3=9Fe, Carsten


From nobody Wed Feb 13 06:10:05 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 88BF112D826 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 06:10:03 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id X7XiZEbqa-rt for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 06:10:01 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 7646C128D0B for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 06:10:01 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:49317 helo=[192.168.1.126]) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_256_CBC_SHA256:256) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gtvEd-0000fb-KK; Wed, 13 Feb 2019 06:10:00 -0800
Content-Type: text/plain; charset=utf-8
Mime-Version: 1.0 (1.0)
From: Henrik Levkowetz <henrik@levkowetz.com>
X-Mailer: iPad Mail (15F79)
In-Reply-To: <8E9B5E78-9E89-4AEB-8CD3-5D52FDDB543D@tzi.org>
Date: Wed, 13 Feb 2019 15:09:52 +0100
Cc: xml2rfc issue tracker <trac@tools.ietf.org>, julian.reschke@gmx.de, xml2rfc@ietf.org
Content-Transfer-Encoding: quoted-printable
Message-Id: <5CB6B224-44AA-4DFF-A8AA-62410C1BC85B@levkowetz.com>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org> <075.2313c628240364e421aaed23d70574c5@tools.ietf.org> <8E9B5E78-9E89-4AEB-8CD3-5D52FDDB543D@tzi.org>
To: Carsten Bormann <cabo@tzi.org>
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: julian.reschke@gmx.de, trac@tools.ietf.org, xml2rfc@ietf.org, cabo@tzi.org, henrik@levkowetz.com
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/eTeL8SmnnCbsTPo3KyNp_54opVU>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 14:10:04 -0000

Ugh. Then it's a problem with a recent lxml. Ok, I'll work backwards towards=
 a functioning lxml now that I can reproduce this.

Best regards,

        Henrik


> On 13 Feb 2019, at 14:58, Carsten Bormann <cabo@tzi.org> wrote:
>=20
>> On Feb 13, 2019, at 14:40, xml2rfc issue tracker <trac@tools.ietf.org> wr=
ote:
>>=20
>> Avoiding Python 2.7.14 and 2.7.15 for now if possible should still let yo=
u
>> get past this.
>=20
> Just tried Python 3.7.1.  Core dump.
>=20
> https://travis-ci.org/cbor-wg/cddl/builds/492709063
>=20
> Gr=C3=BC=C3=9Fe, Carsten
>=20
>=20


From nobody Wed Feb 13 06:16:43 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 0ECFC129441 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 06:16:42 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 2i_WyyCAFiUW for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 06:16:40 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 44D471274D0 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 06:16:40 -0800 (PST)
Received: from localhost ([::1]:38323 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gtvL4-0000As-NX; Wed, 13 Feb 2019 06:16:39 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Wed, 13 Feb 2019 14:16:38 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:9
Message-ID: <075.9f6386ae1afd2cae1c5e8a09d8901005@tools.ietf.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-Trac-Ticket-ID: 393
In-Reply-To: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/PmCah1ZrPIVP7pPr6jkYWQsO3Sw>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 14:16:42 -0000

#393: Core dump on Travis


Comment (by julian.reschke@gmx.de):

 Wild guess:
 https://github.com/lxml/lxml/commit/201b712edf0478e6a94ace984c1e8435bf3bc3c3

-- 
----------------------------+----------------------------------
  Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
      Type:  defect         |     Status:  new
  Priority:  blocker        |  Milestone:
 Component:  Version 2 cli  |    Version:  2.17.*
Resolution:                 |   Keywords:
----------------------------+----------------------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:9>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb 13 07:10:17 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 6472A1274D0 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 07:10:15 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id bonxRQ5sfAO2 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 07:10:09 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 78988126C7E for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 07:10:09 -0800 (PST)
Received: from localhost ([::1]:39882 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gtwAn-0005AA-MG; Wed, 13 Feb 2019 07:10:05 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Wed, 13 Feb 2019 15:10:05 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:10
Message-ID: <075.d64fdbc00e2ffcc7dcfd11ff6f3be2ea@tools.ietf.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-Trac-Ticket-ID: 393
In-Reply-To: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/zALG6xBQ6wp8yhXcbyHyi-2bobo>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 15:10:15 -0000

#393: Core dump on Travis


Comment (by henrik@levkowetz.com):

 Right.  Downgrading lxml from 4.3.1 to 4.3.0 here removes the issue.  I'll
 disallow 4.3.1 in the next release.

-- 
----------------------------+----------------------------------
  Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
      Type:  defect         |     Status:  new
  Priority:  blocker        |  Milestone:
 Component:  Version 2 cli  |    Version:  2.17.*
Resolution:                 |   Keywords:
----------------------------+----------------------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:10>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb 13 07:13:27 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id E5D13126C7E for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 07:13:25 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id eZuIuMhwdkpg for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 07:13:24 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 84C3E1200D7 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 07:13:24 -0800 (PST)
Received: from localhost ([::1]:39975 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gtwDz-0006EJ-FE; Wed, 13 Feb 2019 07:13:23 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Wed, 13 Feb 2019 15:13:23 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: /ticket/393#comment:11
Message-ID: <075.7ae1b8871575558760f180ce30db688d@tools.ietf.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-Trac-Ticket-ID: 393
In-Reply-To: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/SE1OPCUrmzN3pP-WglFK1brJuJE>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 15:13:26 -0000

#393: Core dump on Travis

Changes (by henrik@levkowetz.com):

 * status:  new => closed
 * resolution:   => fixed


Comment:

 Fixed in [2994]:

 Disallow lxml 4.3.1, as it can cause segfaults with some Python versions.
 Fixes issue #393.

-- 
----------------------------+----------------------------------
  Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
      Type:  defect         |     Status:  closed
  Priority:  blocker        |  Milestone:
 Component:  Version 2 cli  |    Version:  2.17.*
Resolution:  fixed          |   Keywords:
----------------------------+----------------------------------

Ticket URL: </ticket/393#comment:11>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb 13 07:14:52 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 1BA30126C7E for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 07:14:51 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id Go_eAkj4zbVI for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 07:14:49 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 99AB01200D7 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 07:14:49 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:51466 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gtwFL-0002VI-QU; Wed, 13 Feb 2019 07:14:48 -0800
To: Carsten Bormann <cabo@tzi.org>, xml2rfc issue tracker <trac@tools.ietf.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org> <075.2313c628240364e421aaed23d70574c5@tools.ietf.org> <8E9B5E78-9E89-4AEB-8CD3-5D52FDDB543D@tzi.org>
Cc: julian.reschke@gmx.de, xml2rfc@ietf.org
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <a87d4182-0456-71b3-2cde-828e25d3b280@levkowetz.com>
Date: Wed, 13 Feb 2019 16:14:39 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <8E9B5E78-9E89-4AEB-8CD3-5D52FDDB543D@tzi.org>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="63f01dKcw2jl7Rv4NJEWPD6mWkhrRI0km"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, julian.reschke@gmx.de, trac@tools.ietf.org, cabo@tzi.org
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/ESZGFa1IZwt9l_oVercBmQMfbZw>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 15:14:51 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--63f01dKcw2jl7Rv4NJEWPD6mWkhrRI0km
Content-Type: multipart/mixed; boundary="Pi9il9blegkhaa4C5OjTfvGvx82jbJrv1";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Carsten Bormann <cabo@tzi.org>,
 xml2rfc issue tracker <trac@tools.ietf.org>
Cc: julian.reschke@gmx.de, xml2rfc@ietf.org
Message-ID: <a87d4182-0456-71b3-2cde-828e25d3b280@levkowetz.com>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
 <075.2313c628240364e421aaed23d70574c5@tools.ietf.org>
 <8E9B5E78-9E89-4AEB-8CD3-5D52FDDB543D@tzi.org>
In-Reply-To: <8E9B5E78-9E89-4AEB-8CD3-5D52FDDB543D@tzi.org>

--Pi9il9blegkhaa4C5OjTfvGvx82jbJrv1
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable

Yes, the issue seems to be lxml=3D=3D4.3.1.  Downgrading to 4.3.0 avoids =
the
segfault here.

	Henrik

On 2019-02-13 14:58, Carsten Bormann wrote:
> On Feb 13, 2019, at 14:40, xml2rfc issue tracker <trac@tools.ietf.org> =
wrote:
>>=20
>> Avoiding Python 2.7.14 and 2.7.15 for now if possible should still let=
 you
>> get past this.
>=20
> Just tried Python 3.7.1.  Core dump.
>=20
> https://travis-ci.org/cbor-wg/cddl/builds/492709063
>=20
> Gr=C3=BC=C3=9Fe, Carsten
>=20
>=20


--Pi9il9blegkhaa4C5OjTfvGvx82jbJrv1--

--63f01dKcw2jl7Rv4NJEWPD6mWkhrRI0km
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxkNGAACgkQTptXS4+7
FxrAWhAAwFoKq1wpe2Amu3orip8qXDPz52g3OTbVWQe/aSVCc/VbOeMDwPI7m6kX
HTOapHLLoiRm8OBQ9FFLZD2vXVRqiFgeFTgcebKclnYU+mUA7dQUm3y6RhWDmvRi
SFZcy16jp9vJAI4xemNCXPnNgJ/Rj7Lh2HK1xVb1ZeLEEJcIO9SOcS7fwFk6qcOW
B/Xm6r6meEfbuo2RJYkf5S36IafAiVHuZpO/m0jiUPFZpnIJhxv6i8RuOIs0pao6
0uuY79EELsw6mU6V+TNbF9KWUnz8O9JFl+I63MNb6u547WCKvfQnu2H0vhMvvuna
UDmqrNrGA25GwTZMQazzaQs7vYyfJkRFRzGiiul5vsFnVh9SSzY2HtqHHGYxFjm1
PmC9TXbUYnDTiDGZ9JvbZAilqYJ1BVDtLHOuUmRLgUPrpmFabm1OXU41VSlt6hSn
7OcuDNyStWsDko7Mx0K1A2xuuNLR8MHmenaW80RHJzQstKTN5K0K7YmzGSC7Do5u
nXZsCnRqAdO5JxY7y4d03NbsZoylWZay1p12Sa9AWArvso7Y78HUuUcZAiAkUUs3
zTPOmUhzkBkCz0aXRugQMffstOox9rGHKomRGBvFI12HEEIGGPaVfBePSLZReTIQ
PmW/5OhUAjnT3e1wj4mwYzGGFBx8o+LZZxX0MyugMDMY+iaseyk=
=/oqX
-----END PGP SIGNATURE-----

--63f01dKcw2jl7Rv4NJEWPD6mWkhrRI0km--


From nobody Wed Feb 13 07:16:24 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 4449B12D827 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 07:16:23 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id nNkfEDwW_FxE for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 07:16:21 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 8576112D826 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 07:16:21 -0800 (PST)
Received: from localhost ([::1]:40096 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gtwGq-0000P8-4F; Wed, 13 Feb 2019 07:16:20 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Wed, 13 Feb 2019 15:16:19 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:12
Message-ID: <075.82cd74329fa56e86170f32c41bae8779@tools.ietf.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-Trac-Ticket-ID: 393
In-Reply-To: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/DSrb8Nru8yCzPKlywShRfwaEgX4>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 15:16:23 -0000

#393: Core dump on Travis


Comment (by julian.reschke@gmx.de):

 Actually, it seems you need to disallow 4.3.0. 4.3.1 fixes the issue, no?

-- 
----------------------------+----------------------------------
  Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
      Type:  defect         |     Status:  closed
  Priority:  blocker        |  Milestone:
 Component:  Version 2 cli  |    Version:  2.17.*
Resolution:  fixed          |   Keywords:
----------------------------+----------------------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:12>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb 13 07:25:25 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 317B3126C7E for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 07:25:24 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id MRj9JHGejG6l for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 07:25:22 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id AAE371200D7 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 07:25:22 -0800 (PST)
Received: from localhost ([::1]:40301 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gtwPL-0003G4-QZ; Wed, 13 Feb 2019 07:25:10 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Wed, 13 Feb 2019 15:25:02 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:13
Message-ID: <075.a9d4e3033b0246db523d5f1694fb9c65@tools.ietf.org>
References: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-Trac-Ticket-ID: 393
In-Reply-To: <060.142be4c16d95f02050e10d01315dcef0@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/ALO6bIfsLdhmcoYa8d4BjV7E8qU>
Subject: Re: [xml2rfc] #393 (Version 2 cli): Core dump on Travis
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 15:25:24 -0000

#393: Core dump on Travis


Comment (by henrik@levkowetz.com):

 Not so in my tests.  With lxml 4.3.1 under Python 2.7.15 I get segfaults,
 with 4.3.0 I don't.  Are you sure that the lxml commit you pointed at
 (reasonable guess) was included in 4.3.1?  It could be slated for the next
 release, maybe?

-- 
----------------------------+----------------------------------
  Reporter:  cabo@tzi.org   |      Owner:  henrik@levkowetz.com
      Type:  defect         |     Status:  closed
  Priority:  blocker        |  Milestone:
 Component:  Version 2 cli  |    Version:  2.17.*
Resolution:  fixed          |   Keywords:
----------------------------+----------------------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393#comment:13>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb 13 09:45:50 2019
Return-Path: <pkyzivat@alum.mit.edu>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 3990B130E7A for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 09:45:49 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id K6_wzB6eu7dd for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 09:45:47 -0800 (PST)
Received: from outgoing-alum.mit.edu (outgoing-alum.mit.edu [18.7.68.33]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 73D67130DE5 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 09:45:47 -0800 (PST)
Received: from PaulKyzivatsMBP.localdomain (c-24-62-227-142.hsd1.ma.comcast.net [24.62.227.142]) (authenticated bits=0) (User authenticated as pkyzivat@ALUM.MIT.EDU) by outgoing-alum.mit.edu (8.14.7/8.12.4) with ESMTP id x1DHjjI9013458 (version=TLSv1/SSLv3 cipher=AES128-SHA bits=128 verify=NOT) for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 12:45:45 -0500
To: xml2rfc@ietf.org
From: Paul Kyzivat <pkyzivat@alum.mit.edu>
Message-ID: <bd44d8c3-3211-6a93-8a21-7694884ca137@alum.mit.edu>
Date: Wed, 13 Feb 2019 12:45:45 -0500
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.10; rv:60.0) Gecko/20100101 Thunderbird/60.5.0
MIME-Version: 1.0
Content-Type: text/plain; charset=utf-8; format=flowed
Content-Language: en-US
Content-Transfer-Encoding: 7bit
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/OO7GZfEXzv6g_FJBFtOHXiYFsZo>
Subject: [xml2rfc] xml2rfc hang today
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 17:45:49 -0000

I am just resuming work on a document that I last worked on in December.
I pulled up the xml file for the last submitted version and reprocessed 
it with https://xml2rfc.tools.ietf.org. It just hangs when I submit it. 
I've tried with both Firefox and Chrome - same result. This is with a 
file (draft-ietf-mmusic-rfc4566bis-32.xml) that worked in December.

	HELP,
	Paul


From nobody Wed Feb 13 09:50:40 2019
Return-Path: <cabo@tzi.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id B7D9B128766 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 09:50:38 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -4.199
X-Spam-Level: 
X-Spam-Status: No, score=-4.199 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_MED=-2.3, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id T-q03CeKKtMp for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 09:50:36 -0800 (PST)
Received: from mailhost.informatik.uni-bremen.de (mailhost.informatik.uni-bremen.de [IPv6:2001:638:708:30c9::12]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 200621289FA for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 09:50:35 -0800 (PST)
X-Virus-Scanned: amavisd-new at informatik.uni-bremen.de
Received: from submithost.informatik.uni-bremen.de (submithost2.informatik.uni-bremen.de [IPv6:2001:638:708:30c8:406a:91ff:fe74:f2b7]) by mailhost.informatik.uni-bremen.de (8.14.5/8.14.5) with ESMTP id x1DHoNoo013151; Wed, 13 Feb 2019 18:50:28 +0100 (CET)
Received: from [192.168.217.106] (p54A6CC50.dip0.t-ipconnect.de [84.166.204.80]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by submithost.informatik.uni-bremen.de (Postfix) with ESMTPSA id 4406W34lPKz1Br6; Wed, 13 Feb 2019 18:50:23 +0100 (CET)
Content-Type: text/plain; charset=utf-8
Mime-Version: 1.0 (Mac OS X Mail 11.5 \(3445.9.1\))
From: Carsten Bormann <cabo@tzi.org>
In-Reply-To: <bd44d8c3-3211-6a93-8a21-7694884ca137@alum.mit.edu>
Date: Wed, 13 Feb 2019 18:50:22 +0100
Cc: xml2rfc@ietf.org
X-Mao-Original-Outgoing-Id: 571773020.728026-afe760ecf58f65e821fc0f06c83506a6
Content-Transfer-Encoding: quoted-printable
Message-Id: <08AC1A2F-7C99-4E24-8F70-F1A2EB75ECA1@tzi.org>
References: <bd44d8c3-3211-6a93-8a21-7694884ca137@alum.mit.edu>
To: Paul Kyzivat <pkyzivat@alum.mit.edu>
X-Mailer: Apple Mail (2.3445.9.1)
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/bpBIs1-ISrYiekPVqtV1dJClq6o>
Subject: Re: [xml2rfc] xml2rfc hang today
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 17:50:39 -0000

Possibly related to

https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393

?

Gr=C3=BC=C3=9Fe, Carsten


> On Feb 13, 2019, at 18:45, Paul Kyzivat <pkyzivat@alum.mit.edu> wrote:
>=20
> I am just resuming work on a document that I last worked on in =
December.
> I pulled up the xml file for the last submitted version and =
reprocessed it with https://xml2rfc.tools.ietf.org. It just hangs when I =
submit it. I've tried with both Firefox and Chrome - same result. This =
is with a file (draft-ietf-mmusic-rfc4566bis-32.xml) that worked in =
December.
>=20
> 	HELP,
> 	Paul
>=20
> _______________________________________________
> xml2rfc mailing list
> xml2rfc@ietf.org
> https://www.ietf.org/mailman/listinfo/xml2rfc
>=20


From nobody Wed Feb 13 09:56:51 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id B0245128766 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 09:56:49 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id oiHGMn3AYpHo for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 09:56:47 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 2065C1200B3 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 09:56:47 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:54220 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gtym6-00045w-43; Wed, 13 Feb 2019 09:56:46 -0800
To: Carsten Bormann <cabo@tzi.org>, Paul Kyzivat <pkyzivat@alum.mit.edu>
References: <bd44d8c3-3211-6a93-8a21-7694884ca137@alum.mit.edu> <08AC1A2F-7C99-4E24-8F70-F1A2EB75ECA1@tzi.org>
Cc: xml2rfc@ietf.org
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <2f5f5485-8588-3ed5-fd4f-30851877eff6@levkowetz.com>
Date: Wed, 13 Feb 2019 18:56:38 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <08AC1A2F-7C99-4E24-8F70-F1A2EB75ECA1@tzi.org>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="ciXp0T8G4pDVcTErqhh7HaxJm5WsMM8R9"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, pkyzivat@alum.mit.edu, cabo@tzi.org
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/WpEafmoe7P1BYiOHKyts7_Xvca4>
Subject: Re: [xml2rfc] xml2rfc hang today
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 17:56:50 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--ciXp0T8G4pDVcTErqhh7HaxJm5WsMM8R9
Content-Type: multipart/mixed; boundary="6VV8DPPMHmn8N3tCFSkg3nwtUFNku5pUw";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Carsten Bormann <cabo@tzi.org>, Paul Kyzivat <pkyzivat@alum.mit.edu>
Cc: xml2rfc@ietf.org
Message-ID: <2f5f5485-8588-3ed5-fd4f-30851877eff6@levkowetz.com>
Subject: Re: [xml2rfc] xml2rfc hang today
References: <bd44d8c3-3211-6a93-8a21-7694884ca137@alum.mit.edu>
 <08AC1A2F-7C99-4E24-8F70-F1A2EB75ECA1@tzi.org>
In-Reply-To: <08AC1A2F-7C99-4E24-8F70-F1A2EB75ECA1@tzi.org>

--6VV8DPPMHmn8N3tCFSkg3nwtUFNku5pUw
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable

No, xml2rfc on the server is running on 2.7.10+ with lxml 4.3.0; should
be OK.

I see however that we have a new set of crawlers that access cpu-intensiv=
e
pages, ignoring robots.txt.

Will clobber them.

	Henrik

On 2019-02-13 18:50, Carsten Bormann wrote:
> Possibly related to
>=20
> https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393
>=20
> ?
>=20
> Gr=C3=BC=C3=9Fe, Carsten
>=20
>=20
>> On Feb 13, 2019, at 18:45, Paul Kyzivat <pkyzivat@alum.mit.edu> wrote:=

>>=20
>> I am just resuming work on a document that I last worked on in Decembe=
r.
>> I pulled up the xml file for the last submitted version and reprocesse=
d it with https://xml2rfc.tools.ietf.org. It just hangs when I submit it.=
 I've tried with both Firefox and Chrome - same result. This is with a fi=
le (draft-ietf-mmusic-rfc4566bis-32.xml) that worked in December.
>>=20
>> 	HELP,
>> 	Paul
>>=20
>> _______________________________________________
>> xml2rfc mailing list
>> xml2rfc@ietf.org
>> https://www.ietf.org/mailman/listinfo/xml2rfc
>>=20
>=20
> _______________________________________________
> xml2rfc mailing list
> xml2rfc@ietf.org
> https://www.ietf.org/mailman/listinfo/xml2rfc
>=20


--6VV8DPPMHmn8N3tCFSkg3nwtUFNku5pUw--

--ciXp0T8G4pDVcTErqhh7HaxJm5WsMM8R9
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxkWlYACgkQTptXS4+7
Fxri4RAAofAfM5PIQb+qjKoIG1qgTmfZPFFSQWYNIgdgJAfCv19NSMBkZtQDWWwY
NOmmeJKk5aFoxufNuTE0bFk8IKbjqPG34cHnTfJdw9IkB08ex4x1rqez+fdgIiHv
LME856t+Iy5DccTJcfg0FI9DX97w7CdWMfIBKj4ufmSHRK5Vx1J5etoPx9GseR8C
NdXh/2P01R9uUTtWCDLNZNn+4jBk0IZ9FnH2KO/pmoOD23m6loMg8VBopgZhJUVv
iaPMgIwRI0Fn9ki/d4uCDjryGqcvIPKIrMzvWybwipc1m/sl/qNuTZUzVbjigcdM
rkP273K+Sel2bGPu56d/Otfxku5xnN/wIEXUeLbx1VTvCYJ9cedWaZWaxG1zsSAD
GdQpnFEtZ7VCu8fUS5/lqrQ6gMkirUg7hLaYYn2uF7zWIk6qAKgB99EAx2tHaE2I
Wpwi5Dvroi9xIg21kkCX3QVuPmdMQ0X5EbQ0gK9LQydA6c+to2RxR17pcDsfV8SO
VripL1HpkXVGB+y2KbTU29o/C7LDdWHStAAJD10wzRpdbQjEM/ENdndWTFC1yPDb
+mDGqtoEPOJ9uozOqHKfVaZI2ItyXOFRKM9gHLYpmMi92MfMN4dGybNOG/5H/ZKe
lzel4w6gFU8bBN4KYH84bu4IhHInFX+p18CKcvnILqX/pLGA8EQ=
=Ru3l
-----END PGP SIGNATURE-----

--ciXp0T8G4pDVcTErqhh7HaxJm5WsMM8R9--


From nobody Wed Feb 13 10:03:12 2019
Return-Path: <pkyzivat@alum.mit.edu>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 3AC5E130DEA for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 10:03:11 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id ghEfYfEMXZx3 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 10:03:09 -0800 (PST)
Received: from outgoing-alum.mit.edu (outgoing-alum.mit.edu [18.7.68.33]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 2171D12F295 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 10:03:08 -0800 (PST)
Received: from PaulKyzivatsMBP.localdomain (c-24-62-227-142.hsd1.ma.comcast.net [24.62.227.142]) (authenticated bits=0) (User authenticated as pkyzivat@ALUM.MIT.EDU) by outgoing-alum.mit.edu (8.14.7/8.12.4) with ESMTP id x1DI325J014703 (version=TLSv1/SSLv3 cipher=AES128-SHA bits=128 verify=NOT); Wed, 13 Feb 2019 13:03:03 -0500
To: Henrik Levkowetz <henrik@levkowetz.com>, Carsten Bormann <cabo@tzi.org>
Cc: xml2rfc@ietf.org
References: <bd44d8c3-3211-6a93-8a21-7694884ca137@alum.mit.edu> <08AC1A2F-7C99-4E24-8F70-F1A2EB75ECA1@tzi.org> <2f5f5485-8588-3ed5-fd4f-30851877eff6@levkowetz.com>
From: Paul Kyzivat <pkyzivat@alum.mit.edu>
Message-ID: <512077db-a85b-a35a-ee91-349313c3cf57@alum.mit.edu>
Date: Wed, 13 Feb 2019 13:03:02 -0500
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.10; rv:60.0) Gecko/20100101 Thunderbird/60.5.0
MIME-Version: 1.0
In-Reply-To: <2f5f5485-8588-3ed5-fd4f-30851877eff6@levkowetz.com>
Content-Type: text/plain; charset=utf-8; format=flowed
Content-Language: en-US
Content-Transfer-Encoding: 8bit
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/F-18ZDpYNBG2dn4N9QZrBhRwp0M>
Subject: Re: [xml2rfc] xml2rfc hang today
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 18:03:11 -0000

On 2/13/19 12:56 PM, Henrik Levkowetz wrote:
> No, xml2rfc on the server is running on 2.7.10+ with lxml 4.3.0; should
> be OK.
> 
> I see however that we have a new set of crawlers that access cpu-intensive
> pages, ignoring robots.txt.
> 
> Will clobber them.

It now seems to be working.

	Thanks,
	Paul

> 	Henrik
> 
> On 2019-02-13 18:50, Carsten Bormann wrote:
>> Possibly related to
>>
>> https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393
>>
>> ?
>>
>> Grüße, Carsten
>>
>>
>>> On Feb 13, 2019, at 18:45, Paul Kyzivat <pkyzivat@alum.mit.edu> wrote:
>>>
>>> I am just resuming work on a document that I last worked on in December.
>>> I pulled up the xml file for the last submitted version and reprocessed it with https://xml2rfc.tools.ietf.org. It just hangs when I submit it. I've tried with both Firefox and Chrome - same result. This is with a file (draft-ietf-mmusic-rfc4566bis-32.xml) that worked in December.
>>>
>>> 	HELP,
>>> 	Paul
>>>
>>> _______________________________________________
>>> xml2rfc mailing list
>>> xml2rfc@ietf.org
>>> https://www.ietf.org/mailman/listinfo/xml2rfc
>>>
>>
>> _______________________________________________
>> xml2rfc mailing list
>> xml2rfc@ietf.org
>> https://www.ietf.org/mailman/listinfo/xml2rfc
>>
> 


From nobody Wed Feb 13 10:24:40 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id CCD71128D52 for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 10:24:38 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id MuVBKUPnmUsX for <xml2rfc@ietfa.amsl.com>; Wed, 13 Feb 2019 10:24:37 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 23C54128B33 for <xml2rfc@ietf.org>; Wed, 13 Feb 2019 10:24:37 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:54443 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gtzD2-0004TG-B9; Wed, 13 Feb 2019 10:24:36 -0800
To: Paul Kyzivat <pkyzivat@alum.mit.edu>, Carsten Bormann <cabo@tzi.org>
References: <bd44d8c3-3211-6a93-8a21-7694884ca137@alum.mit.edu> <08AC1A2F-7C99-4E24-8F70-F1A2EB75ECA1@tzi.org> <2f5f5485-8588-3ed5-fd4f-30851877eff6@levkowetz.com> <512077db-a85b-a35a-ee91-349313c3cf57@alum.mit.edu>
Cc: xml2rfc@ietf.org
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <df0a971a-e6b3-65f7-e2f0-d0043ad50896@levkowetz.com>
Date: Wed, 13 Feb 2019 19:24:28 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <512077db-a85b-a35a-ee91-349313c3cf57@alum.mit.edu>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="vfodWvQkxh7Kj63Fg0QGxH4t1xDWT7eqh"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, cabo@tzi.org, pkyzivat@alum.mit.edu
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/9WQFOx1xB6ROyIYt_YMigDQV9sI>
Subject: Re: [xml2rfc] xml2rfc hang today
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 13 Feb 2019 18:24:39 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--vfodWvQkxh7Kj63Fg0QGxH4t1xDWT7eqh
Content-Type: multipart/mixed; boundary="gLUulluP8LARk45gQLlfIR5NP1LtS109b";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Paul Kyzivat <pkyzivat@alum.mit.edu>, Carsten Bormann <cabo@tzi.org>
Cc: xml2rfc@ietf.org
Message-ID: <df0a971a-e6b3-65f7-e2f0-d0043ad50896@levkowetz.com>
Subject: Re: [xml2rfc] xml2rfc hang today
References: <bd44d8c3-3211-6a93-8a21-7694884ca137@alum.mit.edu>
 <08AC1A2F-7C99-4E24-8F70-F1A2EB75ECA1@tzi.org>
 <2f5f5485-8588-3ed5-fd4f-30851877eff6@levkowetz.com>
 <512077db-a85b-a35a-ee91-349313c3cf57@alum.mit.edu>
In-Reply-To: <512077db-a85b-a35a-ee91-349313c3cf57@alum.mit.edu>

--gLUulluP8LARk45gQLlfIR5NP1LtS109b
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable

NP, Paul; sorry for the bother.

	Henrik

On 2019-02-13 19:03, Paul Kyzivat wrote:
> On 2/13/19 12:56 PM, Henrik Levkowetz wrote:
>> No, xml2rfc on the server is running on 2.7.10+ with lxml 4.3.0; shoul=
d
>> be OK.
>>=20
>> I see however that we have a new set of crawlers that access cpu-inten=
sive
>> pages, ignoring robots.txt.
>>=20
>> Will clobber them.
>=20
> It now seems to be working.
>=20
> 	Thanks,
> 	Paul
>=20
>> 	Henrik
>>=20
>> On 2019-02-13 18:50, Carsten Bormann wrote:
>>> Possibly related to
>>>
>>> https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/393
>>>
>>> ?
>>>
>>> Gr=C3=BC=C3=9Fe, Carsten
>>>
>>>
>>>> On Feb 13, 2019, at 18:45, Paul Kyzivat <pkyzivat@alum.mit.edu> wrot=
e:
>>>>
>>>> I am just resuming work on a document that I last worked on in Decem=
ber.
>>>> I pulled up the xml file for the last submitted version and reproces=
sed it with https://xml2rfc.tools.ietf.org. It just hangs when I submit i=
t. I've tried with both Firefox and Chrome - same result. This is with a =
file (draft-ietf-mmusic-rfc4566bis-32.xml) that worked in December.
>>>>
>>>> 	HELP,
>>>> 	Paul
>>>>
>>>> _______________________________________________
>>>> xml2rfc mailing list
>>>> xml2rfc@ietf.org
>>>> https://www.ietf.org/mailman/listinfo/xml2rfc
>>>>
>>>
>>> _______________________________________________
>>> xml2rfc mailing list
>>> xml2rfc@ietf.org
>>> https://www.ietf.org/mailman/listinfo/xml2rfc
>>>
>>=20
>=20
>=20


--gLUulluP8LARk45gQLlfIR5NP1LtS109b--

--vfodWvQkxh7Kj63Fg0QGxH4t1xDWT7eqh
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxkYNwACgkQTptXS4+7
FxoMdA/+NkSAplUFVvugCyO/3wI7koUeL9FFNu3ZVe14sFrs0M+aLXFnO8h9mIjr
IgOVrEvoC7hWqmD0v/3mfi+Fh7p4IGguFj/YkIqT9QapRHFLSLfVRFKSn2Via0mm
3GAm8uQY61Jo+FQ5UL2VdC9y9ISrUiTZ2nounBPlgk8vY0cfQf15boJ95fCMRMr4
O0Bd2qUhI1U7/BeT2RQQumCeQ1jnhIFdHvFYXJ/24Y4R9hR3OzECuJtCPjC10ExJ
afDaK23rtBdESVKn2xSs7dxdYg8CUACXn/F0zgn8nNMO1MrmUzpSdGfWSpg2sYjv
0za+P/80gPaqftQDRefdmlyz88Mt7uzkUY1qV4mvbz0ofcLbDP8a3qMbgd7uNyWf
F0a+IGn/W+2wCxmdLE1zy83uWEBz9O8wEWxQIQ1h+/T7hUU0ya8EbF7XT/N8F/vI
eBWL+bOpwmJpGL1FQI8RWZbXrablu9RYBkSM77gleqdLM8GfVOptWtlODqDAivfp
PgHd+NT13g33Zp4d70OEFMtxX/f9zZXUFlG7xlUFZ69A87LP0Gxexx+M4kVmOThe
lUoPwOpXV/giVQVRvJs1HHXY/sZsxpV3ej/B2pn725/Uypxtijrov0xktSNfxAtF
FsqorRKUEO+Y9+nH5SiDkKNoLnTS998YlF9zZ+qgDSVQYmGPNVY=
=Hmi1
-----END PGP SIGNATURE-----

--vfodWvQkxh7Kj63Fg0QGxH4t1xDWT7eqh--


From nobody Thu Feb 14 06:20:42 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 9AD7B13106D; Thu, 14 Feb 2019 06:20:35 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id BvWrSQ-oYnYx; Thu, 14 Feb 2019 06:20:33 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 4D342130F0E; Thu, 14 Feb 2019 06:20:33 -0800 (PST)
Received: from henrik by durif.tools.ietf.org with local (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1guHsP-0006fN-5z; Thu, 14 Feb 2019 06:20:33 -0800
To: xml2rfc-dev@ietf.org, xml2rfc@ietf.org
Cc: rfc-markdown@ietf.org
Message-Id: <E1guHsP-0006fN-5z@durif.tools.ietf.org>
From: Henrik Levkowetz <henrik@levkowetz.com>
Date: Thu, 14 Feb 2019 06:20:33 -0800
X-SA-Exim-Connect-IP: <locally generated>
X-SA-Exim-Rcpt-To: rfc-markdown@ietf.org, xml2rfc-dev@ietf.org, xml2rfc@ietf.org
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/S_E8I5DGr47mh5g-sC68NTtFuwE>
Subject: [xml2rfc] New xml2rfc release: v2.19.0
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Thu, 14 Feb 2019 14:20:36 -0000

Hi,

This is an automatic notification about a new xml2rfc release, 
v2.19.0, generated when running the mkrelease script.

Release notes:

xml2rfc (2.19.0) ietf; urgency=medium

   **Changed handling of alternative artwork**

   The way <artwork> has been specified to handle the presence of both
   SVG artwork and text fallback (in Section 2.5 of [RFC7991]) has the
   result that any SVG content has to be placed as a data: URL in the
   "src" attribute when an ascii-art fallback is present.  This makes
   the SVG effectively uneditable once the preptool has been run, even
   if the SVG artwork was originally provided as a regular SVG XML file
   external to the document XML file.

   In order to be able to more easily deal with alternative instances of
   artwork, and in the future possibly deal smoothly with a wider number
   of alternative artwork formats than is currently provided for, a new
   element <artset> could be introduced, presenting a set of alternative
   artwork executions.  This would let the renderer pick the most
   appropriate <artwork> instance for its format from the alternatives
   present within an <artset> element, based on the "type" attribute of
   each enclosed <artwork> element.

   If more than one <artwork> element is found within an <artset>
   element, with the same "type" attribute, the renderer could select
   the first one, or possibly choose between the alternative instances
   based on the output format and some quality of the alternative
   instances that made one more suitable than the other for that
   particular format, such as size, aspect ratio, or whatnot.

   Implementation:  Xml2rfc as of version 2.18.0 implements this, with a
      preference list when rendering to HTML and PDF of ( "svg",
      "binary-art", "ascii-art" ), while the text renderer uses the list
      ( "ascii-art", ) -- i.e., one entry only.  The Relax-NG compact
      schema used for <artset> is this::

        artset =
          element artset {
            attribute xml:base { text }?,
            attribute xml:lang { text }?,
            attribute anchor { xsd:ID }?,
            attribute pn { xsd:ID }?,
            artwork*
          }

      The <artset> element can occur anywhere an <artwork> element can
      occur.  The first anchor on an <artwork> element within an
      <artset> element will be promoted to the <artset> element if it
      has none; apart from that, anchors on <artwork> elements within an
      <artset> element will be removed by the preptool.

   Additionally, this release contains some other fixes and changes.  From
   the commit log:

  * Normalized the expansion of <xref> to be more consistent conceptually 
    and across renderings.  Added back rendering support for format='none'.

  * Added another exception class to the import exception catch for pango,
    to avoid a crash in some environments.

  * Applied a patch from rjs@nostrum.com to improve the xml2rfc description.

  * Disallow lxml 4.3.1, as it can cause segfaults with some Python 
    versions.  Fixes issue #393.

  * Put back LICENCE which has been lost from the source distribution tarball
    at some point.

  * Adjusted the <xref format="counter"/> output for appendices.

  * Added code to remove any usage of Unicode U+2028 LINE SEPARATOR from the
    text output also in legacy mode.

  * Fixed a problem with the text format rendering of <xref> for an appendix.

  * Added a get_element_tags() method in BaseV3Writer, and commented out 
    some debug code.

  * Removed a warning about missing country that would appear even if no 
    <address> or <postal> was supplied.

 -- Henrik Levkowetz <henrik@levkowetz.com>  12 Feb 2019 16:43:44 +0000

The preferred way to install xml2rfc is by doing 'pip install xml2rfc',
and 'pip install --upgrade xml2rfc' to upgrade.  If there are system-
installed python modules which pip will not upgrade, you may have to
use 'pip install --upgrade --no-deps xml2rfc' and install dependencies
manually.

The new version is also available through SVN checkout, with
  'svn checkout http://svn.tools.ietf.org/svn/tools/xml2rfc/tags/cli/2.19.0'

Regards,

	Henrik
	(via the mkrelease script)


From nobody Sat Feb 16 14:24:27 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 456D7130FFE; Sat, 16 Feb 2019 14:24:15 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id c-CHOs9hDhi6; Sat, 16 Feb 2019 14:24:13 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id CA436130FFB; Sat, 16 Feb 2019 14:24:13 -0800 (PST)
Received: from henrik by durif.tools.ietf.org with local (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gv8NZ-0004SO-GT; Sat, 16 Feb 2019 14:24:13 -0800
To: xml2rfc-dev@ietf.org, xml2rfc@ietf.org
Cc: rfc-markdown@ietf.org
Message-Id: <E1gv8NZ-0004SO-GT@durif.tools.ietf.org>
From: Henrik Levkowetz <henrik@levkowetz.com>
Date: Sat, 16 Feb 2019 14:24:13 -0800
X-SA-Exim-Connect-IP: <locally generated>
X-SA-Exim-Rcpt-To: rfc-markdown@ietf.org, xml2rfc-dev@ietf.org, xml2rfc@ietf.org
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/qXu_s8cYIZtvzjp6OsSZiSActHw>
Subject: [xml2rfc] New xml2rfc release: v2.19.1
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Sat, 16 Feb 2019 22:24:15 -0000

Hi,

This is an automatic notification about a new xml2rfc release, 
v2.19.1, generated when running the mkrelease script.

Release notes:

xml2rfc (2.19.1) ietf; urgency=medium

  This is a small bugfix release.  From the commit log:

  * Removed some linux-specific code.

  * Fixed a problem with the handling of comments and PIs inside text 
    blocks.

 -- Henrik Levkowetz <henrik@levkowetz.com>  16 Feb 2019 22:21:25 +0000

The preferred way to install xml2rfc is by doing 'pip install xml2rfc',
and 'pip install --upgrade xml2rfc' to upgrade.  If there are system-
installed python modules which pip will not upgrade, you may have to
use 'pip install --upgrade --no-deps xml2rfc' and install dependencies
manually.

The new version is also available through SVN checkout, with
  'svn checkout http://svn.tools.ietf.org/svn/tools/xml2rfc/tags/cli/2.19.1'

Regards,

	Henrik
	(via the mkrelease script)


From nobody Tue Feb 19 08:14:18 2019
Return-Path: <pkyzivat@alum.mit.edu>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id E9AA9130F17 for <xml2rfc@ietfa.amsl.com>; Tue, 19 Feb 2019 08:14:15 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 40XI4Yyz-BZF for <xml2rfc@ietfa.amsl.com>; Tue, 19 Feb 2019 08:14:14 -0800 (PST)
Received: from outgoing-alum.mit.edu (outgoing-alum.mit.edu [18.7.68.33]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 6DC0A130F11 for <xml2rfc@ietf.org>; Tue, 19 Feb 2019 08:14:14 -0800 (PST)
Received: from PaulKyzivatsMBP.localdomain (c-24-62-227-142.hsd1.ma.comcast.net [24.62.227.142]) (authenticated bits=0) (User authenticated as pkyzivat@ALUM.MIT.EDU) by outgoing-alum.mit.edu (8.14.7/8.12.4) with ESMTP id x1JGE9of007432 (version=TLSv1/SSLv3 cipher=AES128-SHA bits=128 verify=NOT); Tue, 19 Feb 2019 11:14:10 -0500
To: xml2rfc@ietf.org
From: Paul Kyzivat <pkyzivat@alum.mit.edu>
Message-ID: <79600f6c-9f10-2b73-b882-f2bbb00dc27e@alum.mit.edu>
Date: Tue, 19 Feb 2019 11:14:09 -0500
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.10; rv:60.0) Gecko/20100101 Thunderbird/60.5.0
MIME-Version: 1.0
Content-Type: text/plain; charset=utf-8; format=flowed
Content-Language: en-US
Content-Transfer-Encoding: 7bit
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/t0OH2HfRZOJhrELl92K9rTMmv0o>
Subject: [xml2rfc] https://xml2rfc.tools.ietf.org/ not working this morning
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 19 Feb 2019 16:14:16 -0000

I can get to the initial page but when I submit an xml file I either get 
Internal Server Error or else a certificate validation failure. This is 
from both Chrome and Firefox. It was working fine last night.

	Help,
	Paul


From nobody Tue Feb 19 08:22:02 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 78BAC130F20 for <xml2rfc@ietfa.amsl.com>; Tue, 19 Feb 2019 08:22:01 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id q_Gd7bRaDMHK for <xml2rfc@ietfa.amsl.com>; Tue, 19 Feb 2019 08:21:59 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id B7425130F1E for <xml2rfc@ietf.org>; Tue, 19 Feb 2019 08:21:59 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:64430 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gw89e-0001Z3-DV; Tue, 19 Feb 2019 08:21:59 -0800
To: Paul Kyzivat <pkyzivat@alum.mit.edu>, xml2rfc@ietf.org
References: <79600f6c-9f10-2b73-b882-f2bbb00dc27e@alum.mit.edu>
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <6f132ca4-06cd-d3d3-336f-3580a190180b@levkowetz.com>
Date: Tue, 19 Feb 2019 17:21:51 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <79600f6c-9f10-2b73-b882-f2bbb00dc27e@alum.mit.edu>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="kibt3IsP2IrlV6tB4peJHgaCw9OglrkXv"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, pkyzivat@alum.mit.edu
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/kjBU95yxSLs_emuUKy5ljfoomZs>
Subject: Re: [xml2rfc] https://xml2rfc.tools.ietf.org/ not working this morning
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 19 Feb 2019 16:22:02 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--kibt3IsP2IrlV6tB4peJHgaCw9OglrkXv
Content-Type: multipart/mixed; boundary="23IxHJAl0NIAs6nL10iwV3xTdWekHstxD";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Paul Kyzivat <pkyzivat@alum.mit.edu>, xml2rfc@ietf.org
Message-ID: <6f132ca4-06cd-d3d3-336f-3580a190180b@levkowetz.com>
Subject: Re: [xml2rfc] https://xml2rfc.tools.ietf.org/ not working this
 morning
References: <79600f6c-9f10-2b73-b882-f2bbb00dc27e@alum.mit.edu>
In-Reply-To: <79600f6c-9f10-2b73-b882-f2bbb00dc27e@alum.mit.edu>

--23IxHJAl0NIAs6nL10iwV3xTdWekHstxD
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable

Hi Paul,

Yes, the machine is in trouble.  Working to sort it out.

	Henrik

On 2019-02-19 17:14, Paul Kyzivat wrote:
> I can get to the initial page but when I submit an xml file I either ge=
t=20
> Internal Server Error or else a certificate validation failure. This is=
=20
> from both Chrome and Firefox. It was working fine last night.
>=20
> 	Help,
> 	Paul
>=20
> _______________________________________________
> xml2rfc mailing list
> xml2rfc@ietf.org
> https://www.ietf.org/mailman/listinfo/xml2rfc
>=20


--23IxHJAl0NIAs6nL10iwV3xTdWekHstxD--

--kibt3IsP2IrlV6tB4peJHgaCw9OglrkXv
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxsLR8ACgkQTptXS4+7
FxpB+RAAwJFWKWxmrUIj/OY5o26fsE6hKWr5E7R465PayEExbiMiprxVvVJeCoxO
sRB+ONZWAwxkZbpMhgMerzQhHyKhTDobwxsGeQUi5WdjLP5iMi/uGlYXOFm8m9BK
+ewDZEGKOUo1B05aY42303KK+opThtrdM4q5R64R6SExwZL9m9LtQ1mgIQZulMz5
GsdC6jb7/RqvnzhKfALU7L81w/AkVWAtvqz6ixUsvPk4xDkJogQiIVOmY1VrorYd
YLrb0b3NxP0Ix1G//zxCw9TVE3ROtHqQnvc5fpqB1uCC6hecAcSB8XmxjjNVXXuz
gPgkYCCsNvxcYTvdRFMrAWqYOhvwFLyFCP6hz1hIEmImqDLkJ5N3ifilaqTyxJhv
B/KkSEYXXS86Js+E2tafWEFGXQGdifg69WZWuaqoFuiGIS4MMzSriVFKwhA6NYb1
qjMfo4c6RE4qJKXS5+GlP0Z/ysUw7oQedIkh5A+cSmAc+TcOIOkUYGzkSq6Ui8tV
sn7nfRMIxiFJlH5xA3UM6nYMk1UIFj4eRMqZ6FwOeBZMIbnaHP78e2v8qCnZFsBe
Y11tUUhOvQz1te4mVyGLq8MYYw56eVo+PnPWio1T6ImSEctoFy5BHxHJI7l7bkp2
08PYthtpc6rIrJXEVJXrERmlG2+myWYNsOk0MBvTWQSeHQCRdHI=
=ufE7
-----END PGP SIGNATURE-----

--kibt3IsP2IrlV6tB4peJHgaCw9OglrkXv--


From nobody Tue Feb 19 08:25:58 2019
Return-Path: <pkyzivat@alum.mit.edu>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id DD0E0130F1E for <xml2rfc@ietfa.amsl.com>; Tue, 19 Feb 2019 08:25:55 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id V31eOH7Hszps for <xml2rfc@ietfa.amsl.com>; Tue, 19 Feb 2019 08:25:54 -0800 (PST)
Received: from outgoing-alum.mit.edu (outgoing-alum.mit.edu [18.7.68.33]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id AAE5D130F04 for <xml2rfc@ietf.org>; Tue, 19 Feb 2019 08:25:54 -0800 (PST)
Received: from PaulKyzivatsMBP.localdomain (c-24-62-227-142.hsd1.ma.comcast.net [24.62.227.142]) (authenticated bits=0) (User authenticated as pkyzivat@ALUM.MIT.EDU) by outgoing-alum.mit.edu (8.14.7/8.12.4) with ESMTP id x1JGPqVA008129 (version=TLSv1/SSLv3 cipher=AES128-SHA bits=128 verify=NOT) for <xml2rfc@ietf.org>; Tue, 19 Feb 2019 11:25:53 -0500
To: xml2rfc@ietf.org
References: <79600f6c-9f10-2b73-b882-f2bbb00dc27e@alum.mit.edu>
From: Paul Kyzivat <pkyzivat@alum.mit.edu>
Message-ID: <d3620841-7124-5ff6-a8b2-efb2bd4ce1f9@alum.mit.edu>
Date: Tue, 19 Feb 2019 11:25:52 -0500
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.10; rv:60.0) Gecko/20100101 Thunderbird/60.5.0
MIME-Version: 1.0
In-Reply-To: <79600f6c-9f10-2b73-b882-f2bbb00dc27e@alum.mit.edu>
Content-Type: text/plain; charset=utf-8; format=flowed
Content-Language: en-US
Content-Transfer-Encoding: 7bit
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/67l-XOJ2Q3fKCVyurKTEkkEkI48>
Subject: Re: [xml2rfc] https://xml2rfc.tools.ietf.org/ not working this morning
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 19 Feb 2019 16:25:56 -0000

On 2/19/19 11:14 AM, Paul Kyzivat wrote:
> I can get to the initial page but when I submit an xml file I either get 
> Internal Server Error or else a certificate validation failure. This is 
> from both Chrome and Firefox. It was working fine last night.

Clarification: the certificate validation failure is:

The connection to the server was reset while the page was loading.

o  The page you are trying to view cannot be shown because the
    authenticity of the received data could not be verified.

o  Please contact the website owners to inform them of this problem.


From nobody Tue Feb 19 08:43:16 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 8C21D1310C3 for <xml2rfc@ietfa.amsl.com>; Tue, 19 Feb 2019 08:43:12 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id IuVoAOxDQczE for <xml2rfc@ietfa.amsl.com>; Tue, 19 Feb 2019 08:43:11 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 008CE13111E for <xml2rfc@ietf.org>; Tue, 19 Feb 2019 08:43:10 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:64780 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gw8U9-0004d2-UT; Tue, 19 Feb 2019 08:43:10 -0800
To: Paul Kyzivat <pkyzivat@alum.mit.edu>, xml2rfc@ietf.org
References: <79600f6c-9f10-2b73-b882-f2bbb00dc27e@alum.mit.edu> <d3620841-7124-5ff6-a8b2-efb2bd4ce1f9@alum.mit.edu>
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <00c1170f-4192-24ea-10b3-d3d0de11122c@levkowetz.com>
Date: Tue, 19 Feb 2019 17:43:02 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <d3620841-7124-5ff6-a8b2-efb2bd4ce1f9@alum.mit.edu>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="THEkvlqcii9DovNgcELbvsSmR2uVMA6k7"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, pkyzivat@alum.mit.edu
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/aS0KaRSTREVrJ8pyKxXTFjAWulk>
Subject: Re: [xml2rfc] https://xml2rfc.tools.ietf.org/ not working this morning
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 19 Feb 2019 16:43:15 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--THEkvlqcii9DovNgcELbvsSmR2uVMA6k7
Content-Type: multipart/mixed; boundary="Vs869M7sPjoLQVRr4flqXdTKbKJ2KTRkS";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Paul Kyzivat <pkyzivat@alum.mit.edu>, xml2rfc@ietf.org
Message-ID: <00c1170f-4192-24ea-10b3-d3d0de11122c@levkowetz.com>
Subject: Re: [xml2rfc] https://xml2rfc.tools.ietf.org/ not working this
 morning
References: <79600f6c-9f10-2b73-b882-f2bbb00dc27e@alum.mit.edu>
 <d3620841-7124-5ff6-a8b2-efb2bd4ce1f9@alum.mit.edu>
In-Reply-To: <d3620841-7124-5ff6-a8b2-efb2bd4ce1f9@alum.mit.edu>

--Vs869M7sPjoLQVRr4flqXdTKbKJ2KTRkS
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable


On 2019-02-19 17:25, Paul Kyzivat wrote:
> On 2/19/19 11:14 AM, Paul Kyzivat wrote:
>> I can get to the initial page but when I submit an xml file I either g=
et=20
>> Internal Server Error or else a certificate validation failure. This i=
s=20
>> from both Chrome and Firefox. It was working fine last night.
>=20
> Clarification: the certificate validation failure is:
>=20
> The connection to the server was reset while the page was loading.
>=20
> o  The page you are trying to view cannot be shown because the
>     authenticity of the received data could not be verified.
>=20
> o  Please contact the website owners to inform them of this problem.

Ack.  The server is in serious trouble after a spam run, and I'm working
at recovery.  Sorry for the trouble.

Best,

	Henrik


--Vs869M7sPjoLQVRr4flqXdTKbKJ2KTRkS--

--THEkvlqcii9DovNgcELbvsSmR2uVMA6k7
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxsMhYACgkQTptXS4+7
FxrXXA/+P/hB1+kfWKUIdJqbYNEdosxLrjlkDnayMlD1N+EoW0CLrMUzuKMhTyQ0
f9hSyX18E1HocPYG9Dg/W5KV0EZNwUikBb9zLn1VwDv4kgZz7gca74T5qGU/z1oj
2R94mt63WhqtV5HZj37JeLw85mv2yQnpVR6CGgfLpBPj8d5ciULvFekFLhXAqn8o
1+M2E9jp6a2q4+xTQwqFT8iKNeSk1a5DcYavufZUy2FosnN2FlXIHBHuJHoxbghx
VDyXtGRcmWYoMx7UIq7+ldAVsZXO/G4ZhqwHYZdWMKdBQAqdZpU0XwMMEOloKA2e
qVPYXbkImolxifChDgjebp3d5X1nAduNrMUNg5acwuLMV7+i5P47GvLmv4hn1JBL
fSkgy/NWi+3ZL3sup3lenax9DtJRFRpdNHmE+zQ+FR2EAs8tcKPVRwSmS3UqCs83
nM9TsxS3bIVuggOqv+T2WN1qT9D6ac8VtVE7wDk4YH2qarTjEIarywXv9fZOo+wZ
A0etECI0T9U6pVCaHr6xZ3rBNQHpJ3FfN8YrUq/UAdPlP7bzhe9bdEk05clZ78lz
0Mco8bM1foX71XUK2YftLo2tIKPBdcrOod3CVy5VG2U0N4z7UmOyBRayIACtNs0P
x0xaoI9gQB9m7SiD0UKASR2bE2vK6SYbgTQ9TWyxYlYW3yJe5+g=
=3pYX
-----END PGP SIGNATURE-----

--THEkvlqcii9DovNgcELbvsSmR2uVMA6k7--


From nobody Tue Feb 19 08:47:52 2019
Return-Path: <pkyzivat@alum.mit.edu>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id AF293130F2A for <xml2rfc@ietfa.amsl.com>; Tue, 19 Feb 2019 08:47:49 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, SPF_PASS=-0.001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id kfHzWDqOLEYY for <xml2rfc@ietfa.amsl.com>; Tue, 19 Feb 2019 08:47:48 -0800 (PST)
Received: from outgoing-alum.mit.edu (outgoing-alum.mit.edu [18.7.68.33]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id D49C3130F14 for <xml2rfc@ietf.org>; Tue, 19 Feb 2019 08:47:47 -0800 (PST)
Received: from PaulKyzivatsMBP.localdomain (c-24-62-227-142.hsd1.ma.comcast.net [24.62.227.142]) (authenticated bits=0) (User authenticated as pkyzivat@ALUM.MIT.EDU) by outgoing-alum.mit.edu (8.14.7/8.12.4) with ESMTP id x1JGlhjh009551 (version=TLSv1/SSLv3 cipher=AES128-SHA bits=128 verify=NOT); Tue, 19 Feb 2019 11:47:44 -0500
To: Henrik Levkowetz <henrik@levkowetz.com>, xml2rfc@ietf.org
References: <79600f6c-9f10-2b73-b882-f2bbb00dc27e@alum.mit.edu> <d3620841-7124-5ff6-a8b2-efb2bd4ce1f9@alum.mit.edu> <00c1170f-4192-24ea-10b3-d3d0de11122c@levkowetz.com>
From: Paul Kyzivat <pkyzivat@alum.mit.edu>
Message-ID: <e67130c3-9838-de51-d049-7c0d44c334ce@alum.mit.edu>
Date: Tue, 19 Feb 2019 11:47:43 -0500
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.10; rv:60.0) Gecko/20100101 Thunderbird/60.5.0
MIME-Version: 1.0
In-Reply-To: <00c1170f-4192-24ea-10b3-d3d0de11122c@levkowetz.com>
Content-Type: text/plain; charset=utf-8; format=flowed
Content-Language: en-US
Content-Transfer-Encoding: 7bit
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/RD3BIC00NNKgEChcQLrI4OrpObM>
Subject: Re: [xml2rfc] https://xml2rfc.tools.ietf.org/ not working this morning
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 19 Feb 2019 16:47:50 -0000

On 2/19/19 11:43 AM, Henrik Levkowetz wrote:
> 
> On 2019-02-19 17:25, Paul Kyzivat wrote:
>> On 2/19/19 11:14 AM, Paul Kyzivat wrote:
>>> I can get to the initial page but when I submit an xml file I either get
>>> Internal Server Error or else a certificate validation failure. This is
>>> from both Chrome and Firefox. It was working fine last night.
>>
>> Clarification: the certificate validation failure is:
>>
>> The connection to the server was reset while the page was loading.
>>
>> o  The page you are trying to view cannot be shown because the
>>      authenticity of the received data could not be verified.
>>
>> o  Please contact the website owners to inform them of this problem.
> 
> Ack.  The server is in serious trouble after a spam run, and I'm working
> at recovery.  Sorry for the trouble.

	Thanks!


From nobody Tue Feb 19 14:26:40 2019
Return-Path: <pkyzivat@alum.mit.edu>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 7E31E130FA8 for <xml2rfc@ietfa.amsl.com>; Tue, 19 Feb 2019 14:26:38 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.934
X-Spam-Level: 
X-Spam-Status: No, score=-1.934 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, RCVD_IN_DNSWL_LOW=-0.7, SPF_SOFTFAIL=0.665, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no
Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (2048-bit key) header.d=comcastmailservice.net
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 5-8Gz2IpC13k for <xml2rfc@ietfa.amsl.com>; Tue, 19 Feb 2019 14:26:37 -0800 (PST)
Received: from resqmta-ch2-10v.sys.comcast.net (resqmta-ch2-10v.sys.comcast.net [IPv6:2001:558:fe21:29:69:252:207:42]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 24F44128BCC for <xml2rfc@ietf.org>; Tue, 19 Feb 2019 14:26:37 -0800 (PST)
Received: from resomta-ch2-11v.sys.comcast.net ([69.252.207.107]) by resqmta-ch2-10v.sys.comcast.net with ESMTP id wAt2g3hkEEVJDwDqWg3kFl; Tue, 19 Feb 2019 22:26:36 +0000
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcastmailservice.net; s=20180828_2048; t=1550615196; bh=+xUxNMZYjo84RGz5/kqQnEwqOoZdS5iNfwtC+/nIazw=; h=Received:Received:Subject:To:From:Message-ID:Date:MIME-Version: Content-Type; b=Do23ypROSsi5z+KJzhIOQIeE4rxYkhT1Ev6jLpCmJOAwl05EYhhKK7nh7RD1DdfS4 Anvy+uA27UkLt8IadqVCaN6+fStq3X3LgGPbd9EOCDL/hbhoSyIXPW0uafA5zp/RAz JzY9aQ4P0jXfo6bvVgEHsv4lbdneFRXw47wpoYw/AoEkqzn70nFYbbfijURzJTZrPf 2J/DCHOfIJFln4/4WQMAo777pRBcfbehQZbx1DFIjtq5/ZhQzkL1MCxmcioy9NhjYN 69mbF3V2mce4adfDLOjDzHAriOYWEhNvFGr9XJR6SbQ2KX0BabuzgDwHhoMzmZrRqV 4SRThx8i7s8eg==
Received: from PaulKyzivatsMBP.localdomain ([24.62.227.142]) by resomta-ch2-11v.sys.comcast.net with ESMTPA id wDqUgMmx36FMCwDqVgjzv5; Tue, 19 Feb 2019 22:26:36 +0000
X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedutddrtdeggdduheelucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvpdfpqffurfetoffkrfenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhepuffvfhfhkffffgggjggtgfesthejredttdefjeenucfhrhhomheprfgruhhlucfmhiiiihhvrghtuceophhkhiiiihhvrghtsegrlhhumhdrmhhithdrvgguuheqnecuffhomhgrihhnpehivghtfhdrohhrghenucfkphepvdegrdeivddrvddvjedrudegvdenucfrrghrrghmpehhvghloheprfgruhhlmfihiihivhgrthhsofeurfdrlhhotggrlhguohhmrghinhdpihhnvghtpedvgedriedvrddvvdejrddugedvpdhmrghilhhfrhhomhepphhkhiiiihhvrghtsegrlhhumhdrmhhithdrvgguuhdprhgtphhtthhopeigmhhlvdhrfhgtsehivghtfhdrohhrghdprhgtphhtthhopehhvghnrhhikheslhgvvhhkohifvghtiidrtghomhenucevlhhushhtvghrufhiiigvpedt
X-Xfinity-VMeta: sc=-100;st=legit
To: Henrik Levkowetz <henrik@levkowetz.com>, xml2rfc@ietf.org
References: <79600f6c-9f10-2b73-b882-f2bbb00dc27e@alum.mit.edu> <d3620841-7124-5ff6-a8b2-efb2bd4ce1f9@alum.mit.edu> <00c1170f-4192-24ea-10b3-d3d0de11122c@levkowetz.com>
From: Paul Kyzivat <pkyzivat@alum.mit.edu>
Message-ID: <783853e0-1f75-9b06-bf69-e605bdd4b9bd@alum.mit.edu>
Date: Tue, 19 Feb 2019 17:26:34 -0500
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.10; rv:60.0) Gecko/20100101 Thunderbird/60.5.0
MIME-Version: 1.0
In-Reply-To: <00c1170f-4192-24ea-10b3-d3d0de11122c@levkowetz.com>
Content-Type: text/plain; charset=utf-8; format=flowed
Content-Language: en-US
Content-Transfer-Encoding: 7bit
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/M2q7N_e0UOH4vIXC2lfFfH6vTXg>
Subject: Re: [xml2rfc] https://xml2rfc.tools.ietf.org/ not working this morning
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 19 Feb 2019 22:26:39 -0000

I've been trying off and on, and just had a success!

OTOH, it was *very* slow, so I guess it is still a work in progress or 
else it is back under attack again.

	Thanks!!!
	Paul

On 2/19/19 11:43 AM, Henrik Levkowetz wrote:
> 
> On 2019-02-19 17:25, Paul Kyzivat wrote:
>> On 2/19/19 11:14 AM, Paul Kyzivat wrote:
>>> I can get to the initial page but when I submit an xml file I either get
>>> Internal Server Error or else a certificate validation failure. This is
>>> from both Chrome and Firefox. It was working fine last night.
>>
>> Clarification: the certificate validation failure is:
>>
>> The connection to the server was reset while the page was loading.
>>
>> o  The page you are trying to view cannot be shown because the
>>      authenticity of the received data could not be verified.
>>
>> o  Please contact the website owners to inform them of this problem.
> 
> Ack.  The server is in serious trouble after a spam run, and I'm working
> at recovery.  Sorry for the trouble.
> 
> Best,
> 
> 	Henrik
> 


From nobody Tue Feb 19 15:06:50 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 26D9F130FA9 for <xml2rfc@ietfa.amsl.com>; Tue, 19 Feb 2019 15:06:48 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id QEYWFTMjqoZp for <xml2rfc@ietfa.amsl.com>; Tue, 19 Feb 2019 15:06:46 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 755E41274D0 for <xml2rfc@ietf.org>; Tue, 19 Feb 2019 15:06:46 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:52843 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gwETN-0005GR-4v; Tue, 19 Feb 2019 15:06:45 -0800
To: Paul Kyzivat <pkyzivat@alum.mit.edu>, xml2rfc@ietf.org
References: <79600f6c-9f10-2b73-b882-f2bbb00dc27e@alum.mit.edu> <d3620841-7124-5ff6-a8b2-efb2bd4ce1f9@alum.mit.edu> <00c1170f-4192-24ea-10b3-d3d0de11122c@levkowetz.com> <783853e0-1f75-9b06-bf69-e605bdd4b9bd@alum.mit.edu>
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <66e34550-0d2f-c8a5-a9f6-ca0210581b63@levkowetz.com>
Date: Wed, 20 Feb 2019 00:06:37 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <783853e0-1f75-9b06-bf69-e605bdd4b9bd@alum.mit.edu>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="tpsuHlFKrG0boDvlvxLj8lJP19VrEPMlP"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, pkyzivat@alum.mit.edu
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/j7CIxJHwufso-Yb9BllrB28nnrQ>
Subject: Re: [xml2rfc] https://xml2rfc.tools.ietf.org/ not working this morning
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 19 Feb 2019 23:06:48 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--tpsuHlFKrG0boDvlvxLj8lJP19VrEPMlP
Content-Type: multipart/mixed; boundary="5B5L3N4alOL1adl7QWsgLFJmjEpJVspdg";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Paul Kyzivat <pkyzivat@alum.mit.edu>, xml2rfc@ietf.org
Message-ID: <66e34550-0d2f-c8a5-a9f6-ca0210581b63@levkowetz.com>
Subject: Re: [xml2rfc] https://xml2rfc.tools.ietf.org/ not working this
 morning
References: <79600f6c-9f10-2b73-b882-f2bbb00dc27e@alum.mit.edu>
 <d3620841-7124-5ff6-a8b2-efb2bd4ce1f9@alum.mit.edu>
 <00c1170f-4192-24ea-10b3-d3d0de11122c@levkowetz.com>
 <783853e0-1f75-9b06-bf69-e605bdd4b9bd@alum.mit.edu>
In-Reply-To: <783853e0-1f75-9b06-bf69-e605bdd4b9bd@alum.mit.edu>

--5B5L3N4alOL1adl7QWsgLFJmjEpJVspdg
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable

Hi Paul,

On 2019-02-19 23:26, Paul Kyzivat wrote:
> I've been trying off and on, and just had a success!
>=20
> OTOH, it was *very* slow, so I guess it is still a work in progress or =

> else it is back under attack again.

It was.  I've just constructed a new fail2ban rule that should help with
this in the future.

It should be all well and happy now.

Best regards,

	Henrik

> 	Thanks!!!
> 	Paul
>=20
> On 2/19/19 11:43 AM, Henrik Levkowetz wrote:
>>=20
>> On 2019-02-19 17:25, Paul Kyzivat wrote:
>>> On 2/19/19 11:14 AM, Paul Kyzivat wrote:
>>>> I can get to the initial page but when I submit an xml file I either=
 get
>>>> Internal Server Error or else a certificate validation failure. This=
 is
>>>> from both Chrome and Firefox. It was working fine last night.
>>>
>>> Clarification: the certificate validation failure is:
>>>
>>> The connection to the server was reset while the page was loading.
>>>
>>> o  The page you are trying to view cannot be shown because the
>>>      authenticity of the received data could not be verified.
>>>
>>> o  Please contact the website owners to inform them of this problem.
>>=20
>> Ack.  The server is in serious trouble after a spam run, and I'm worki=
ng
>> at recovery.  Sorry for the trouble.
>>=20
>> Best,
>>=20
>> 	Henrik
>>=20
>=20
>=20


--5B5L3N4alOL1adl7QWsgLFJmjEpJVspdg--

--tpsuHlFKrG0boDvlvxLj8lJP19VrEPMlP
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxsi/0ACgkQTptXS4+7
FxrwkQ//d8myMJ7kNRS507i09j/N0Cb2x0mnjKw6u9Dla5ASaokjhMeiRojayA2x
MLwbbbYSBdDcP/+BgnMcrhvg87VgXh7hnEnJm4vefHuRRmQlocb1oKTgC3eK66Lo
roVYGBt6bzEbT7fYjPFHV0Ir9XCa81dfJrSnfqEgqN6Rv3nMDhNeZd4gy428pcsA
RZs4miM0KGfEv/gaX88LL03PjmfQhhIbIi0vJhF6NCS+0nOTAsx2R0Jbyg+FQoXH
rMr38fE/MmShdWZG1Cqiu/WyuM/1Ix0GlmRi8vWWrqLe9yduNPPb1uVkG37LxyEe
NEtmNVbnfm4H4B/qyg36Pad8u37SdupsJKeG0T1F1GiMAI/sbKNMsNeddhV8FRVA
RmgXerGMu3DaBQ3ld6NDTHoaal/UaJMMJNNY0UZ4f0gpGdpTS/UAZoFs51tE2z00
yoDN16jb7CeZXXS3CaRvN/c/xynoSAX4cbs1I5T07FrPtxrmyDAitzf9wCpJTtsl
me2Pqn9DqTMMRbsRFNeiOW1C01iiUqJ/c7ES/+e8X8570TE6paJQleYlnDNBNoAS
CxatWScPCrXi0dBPAbmmHHzaRewDnMAdj8fyo0VUqe210qNOb+g8iWxF8m7Z9qBI
QhfHPxeJiBl94grZm1dQwVCjqPiHitWpRkoliJXSWadb5OmUfVg=
=UTrP
-----END PGP SIGNATURE-----

--tpsuHlFKrG0boDvlvxLj8lJP19VrEPMlP--


From nobody Thu Feb 21 09:11:55 2019
Return-Path: <sarikaya2012@gmail.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 868B112941A for <xml2rfc@ietfa.amsl.com>; Thu, 21 Feb 2019 09:11:53 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.749
X-Spam-Level: 
X-Spam-Status: No, score=-1.749 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, FREEMAIL_ENVFROM_END_DIGIT=0.25, FREEMAIL_FROM=0.001, HTML_MESSAGE=0.001, RCVD_IN_DNSWL_NONE=-0.0001, SPF_PASS=-0.001] autolearn=no autolearn_force=no
Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (2048-bit key) header.d=gmail.com
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id dhQjwuucXr9g for <xml2rfc@ietfa.amsl.com>; Thu, 21 Feb 2019 09:11:52 -0800 (PST)
Received: from mail-yb1-xb34.google.com (mail-yb1-xb34.google.com [IPv6:2607:f8b0:4864:20::b34]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id F0CC11200D7 for <xml2rfc@ietf.org>; Thu, 21 Feb 2019 09:11:51 -0800 (PST)
Received: by mail-yb1-xb34.google.com with SMTP id j85so7833928ybg.11 for <xml2rfc@ietf.org>; Thu, 21 Feb 2019 09:11:51 -0800 (PST)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025;  h=mime-version:reply-to:from:date:message-id:subject:to; bh=s1h2IlvT42pZ/IKHSW6cfQC2ITf8zqMVumeuONLf/Ko=; b=n+62MAVHRaULUnGOac2yWORtJXeEY1x+i0FSVJ1xoRjwXbLgqqD+qCHazitvAE2nSC 0bINoqNWw6yl24AAMSC1m/rydPjjPsKNWKpDW7RRTDNB5qRw8nqYoIrdUdjU4Xh85xZb rWQFM3PVNnw++BDWxoTf7fGI+G2Q4Wtvbs9kfZyL4vsjrYRLbZqleYhqfD7aMTiONzPs g6p2xZaUoOxdb21+VKN1E/o2m0KZuklCPe1xmn/Un8NBRgSiQeG8lJrl16IQG2nt0+Js tzmmFXLYM6RlMsKC4S4z4XsoWclLvnDG6tiRwg82NSNyP5hsoCYTmOsjiMgz+sgG01Q8 094w==
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:reply-to:from:date:message-id :subject:to; bh=s1h2IlvT42pZ/IKHSW6cfQC2ITf8zqMVumeuONLf/Ko=; b=p4iC38Q8+mwouVKtrvJGV8fc6JwzAAM1L8f0YL7kuk1LzqBuPPlSyIaqFu8WMl1WcQ VPXIKhiAam5gG5I0/ekyMbSb7jeWtnH9pMEKaNTcDfsVfMYpzl/2ZiZSUSx6cvFi+MI5 9nZb+gTay0JuqiPS3+4CdxMXxfR0kfiSI059IXN79N6eqGsgLYD622zYH0Mqh7Yzw/V8 hxyM6mBiNbjFtSLcnvK8R+6QR6CdySehV4+RSacEnyXwft4T3tqCBwqmSOuL7wiLXyzK XU4ZO9y2J7ToYau42rbEuAFaDNIi6M53FH3HFg5/uWG05ONXWx11/fSH4c8lRUEseUcm GQOQ==
X-Gm-Message-State: AHQUAuaSIiYilfSRjEjiaEyEuZgtJ6YOTsN4qBzTt2GzatlCav7oSeVd ySAWq1sAzOi/QTwP/vfvk5Pqext/E7YJUlGN2MVc8Q==
X-Google-Smtp-Source: AHgI3IalY6PzZ50d9AAGvcdpFeek8EVba0oKnDqKdim14+a9B+6gUrVAxvCY101GgZCpKC7qLrkP5VOS2RS073Ys3SA=
X-Received: by 2002:a25:dc49:: with SMTP id y70mr34197367ybe.288.1550769110654;  Thu, 21 Feb 2019 09:11:50 -0800 (PST)
MIME-Version: 1.0
Reply-To: sarikaya@ieee.org
From: Behcet Sarikaya <sarikaya2012@gmail.com>
Date: Thu, 21 Feb 2019 11:11:39 -0600
Message-ID: <CAC8QAcfjNCU2+_ipzepNUX+3U_=0mL4gTT8UwkKSp6C7bQq3YA@mail.gmail.com>
To: xml2rfc@ietf.org
Content-Type: multipart/alternative; boundary="000000000000f8220f05826a9161"
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/iPtrPSmwJUiUgJmqKT54un8h5qY>
Subject: [xml2rfc] bibxml to BibTeX (again?)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Thu, 21 Feb 2019 17:11:54 -0000

--000000000000f8220f05826a9161
Content-Type: text/plain; charset="UTF-8"

Hi,

Is there a URL I can get bibxml references in bib tex format?
Or a converter (in python) to convert my XMLRFC references into BibTeX
format?

Thanks,

Behcet

--000000000000f8220f05826a9161
Content-Type: text/html; charset="UTF-8"
Content-Transfer-Encoding: quoted-printable

<div dir=3D"ltr">Hi,<div><br></div><div>Is there a URL I can get bibxml ref=
erences in bib tex format?=C2=A0</div><div>Or a converter (in python) to co=
nvert my XMLRFC references into BibTeX format?</div><div><br></div><div>Tha=
nks,</div><div><br></div><div>Behcet</div></div>

--000000000000f8220f05826a9161--


From nobody Fri Feb 22 01:42:52 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id AA200124D68 for <xml2rfc@ietfa.amsl.com>; Fri, 22 Feb 2019 01:42:50 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id HQSKxa3UO0cc for <xml2rfc@ietfa.amsl.com>; Fri, 22 Feb 2019 01:42:49 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 3D414124BF6 for <xml2rfc@ietf.org>; Fri, 22 Feb 2019 01:42:48 -0800 (PST)
Received: from localhost ([::1]:44276 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gx7M0-0002ll-29; Fri, 22 Feb 2019 01:42:48 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Fri, 22 Feb 2019 09:42:46 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/394
Message-ID: <069.a05c5e71d0eb576af6e425ce1f787ea0@tools.ietf.org>
X-Trac-Ticket-ID: 394
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/98HMmCPAMq3tREABBk418Swws10>
Subject: [xml2rfc] #394 (Version_3_cli_txt): Misleading text output for SVG artwork
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Fri, 22 Feb 2019 09:42:51 -0000

#394: Misleading text output for SVG artwork

 For SVG inside <artwork> without type attribute, the generated output in
 text mode is:

    (Artwork only available as (unknown type): <None>)

 Not sure what the <None> is about, but the type should be known.

-- 
-----------------------------------+--------------------
 Reporter:  julian.reschke@gmx.de  |      Owner:
     Type:  defect                 |     Status:  new
 Priority:  medium                 |  Milestone:
Component:  Version_3_cli_txt      |    Version:  2.19.*
 Keywords:                         |
-----------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/394>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Fri Feb 22 01:44:45 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 395A0124BF6 for <xml2rfc@ietfa.amsl.com>; Fri, 22 Feb 2019 01:44:44 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id ACbprLekWC9J for <xml2rfc@ietfa.amsl.com>; Fri, 22 Feb 2019 01:44:41 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id BC81D1277CC for <xml2rfc@ietf.org>; Fri, 22 Feb 2019 01:44:40 -0800 (PST)
Received: from localhost ([::1]:44318 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gx7No-0006nd-Eb; Fri, 22 Feb 2019 01:44:40 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Fri, 22 Feb 2019 09:44:40 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/395
Message-ID: <069.35a79c47f69de241e972bc2abe6653e3@tools.ietf.org>
X-Trac-Ticket-ID: 395
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/VsgNLP9m_eUoRWlLqFHBqTLpEoU>
Subject: [xml2rfc] #395 (Version_3_cli_html): html generation fails for SVG artwork
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Fri, 22 Feb 2019 09:44:44 -0000

#395: html generation fails for SVG artwork

 Given the attached example, generation of HTML output fails with:

 Parsing file abnftest.xml
 abnftest.xml(12): Error: Expected ascii-art artwork for <artwork type="">,
 but found <artwork xmlns:xlink="http://www.w3.org/1999/xlink"
 xmlns:svg="http://www.w3.org/2000/svg"
 xmlns:xi="http://www.w3.org/2001/XInc...
 Not creating output file due to errors (see above)

-- 
-----------------------------------+--------------------
 Reporter:  julian.reschke@gmx.de  |      Owner:
     Type:  defect                 |     Status:  new
 Priority:  medium                 |  Milestone:
Component:  Version_3_cli_html     |    Version:  2.19.*
 Keywords:                         |
-----------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/395>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Fri Feb 22 04:36:29 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 7EBA512E04D for <xml2rfc@ietfa.amsl.com>; Fri, 22 Feb 2019 04:36:27 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id m3EQ4y3xlqXY for <xml2rfc@ietfa.amsl.com>; Fri, 22 Feb 2019 04:36:25 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id E6CFE129619 for <xml2rfc@ietf.org>; Fri, 22 Feb 2019 04:36:24 -0800 (PST)
Received: from localhost ([::1]:49496 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gxA40-00058J-7D; Fri, 22 Feb 2019 04:36:24 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com
X-Trac-Project: xml2rfc
Date: Fri, 22 Feb 2019 12:36:23 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/394#comment:1
Message-ID: <084.09d7eccf49d8699e7799abbe7d9b74ca@tools.ietf.org>
References: <069.a05c5e71d0eb576af6e425ce1f787ea0@tools.ietf.org>
X-Trac-Ticket-ID: 394
In-Reply-To: <069.a05c5e71d0eb576af6e425ce1f787ea0@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/IdSKb3zIqJqcZDmjGfobB9Bxc0E>
Subject: Re: [xml2rfc] #394 (Version_3_cli_txt): Misleading text output for SVG artwork
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Fri, 22 Feb 2019 12:36:28 -0000

#394: Misleading text output for SVG artwork

Changes (by henrik@levkowetz.com):

 * status:  new => closed
 * resolution:   => invalid


Comment:

 The artwork element in the file is:

 {{{
   <artwork alt="FOO"> ...
 }}}

 so there is no type information available when looking at the artwork
 element.  xml2rfc could do inspection of the element content to determine
 the type, certainly, but this has not been implemented, and it's not clear
 that it would be a win in the end.  Explicit is probably better,
 especially when the renderers have to choose the best type from
 alternative artwork executions, depending on output format.

 I'd have liked to let the {{{type}}} attribute on {{{<artwork>}}} have a
 default value, but that would cause incompatibility with legacy input
 files.

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  closed
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_txt      |    Version:  2.19.*
Resolution:  invalid                |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/394#comment:1>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Fri Feb 22 04:37:55 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 81F57130E89 for <xml2rfc@ietfa.amsl.com>; Fri, 22 Feb 2019 04:37:46 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id OO1UpXrjifSw for <xml2rfc@ietfa.amsl.com>; Fri, 22 Feb 2019 04:37:44 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 80FFE130F18 for <xml2rfc@ietf.org>; Fri, 22 Feb 2019 04:37:44 -0800 (PST)
Received: from localhost ([::1]:49530 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gxA5H-0007o5-VO; Fri, 22 Feb 2019 04:37:43 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com
X-Trac-Project: xml2rfc
Date: Fri, 22 Feb 2019 12:37:43 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/395#comment:1
Message-ID: <084.46c97eb687e5a97a55fa383fd0a670d3@tools.ietf.org>
References: <069.35a79c47f69de241e972bc2abe6653e3@tools.ietf.org>
X-Trac-Ticket-ID: 395
In-Reply-To: <069.35a79c47f69de241e972bc2abe6653e3@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/k6GHclPVxMsEAzS1jU1XYl_beJU>
Subject: Re: [xml2rfc] #395 (Version_3_cli_html): html generation fails for SVG artwork
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Fri, 22 Feb 2019 12:37:53 -0000

#395: html generation fails for SVG artwork

Changes (by henrik@levkowetz.com):

 * status:  new => closed
 * resolution:   => invalid


Comment:

 With no type information given, the interpretation is that this is legacy
 artwork, and thus ascii-art is expected.

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  closed
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_html     |    Version:  2.19.*
Resolution:  invalid                |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/395#comment:1>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Sat Feb 23 03:24:32 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 2326B13107F for <xml2rfc@ietfa.amsl.com>; Sat, 23 Feb 2019 03:24:31 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id A3VkutonI2Xc for <xml2rfc@ietfa.amsl.com>; Sat, 23 Feb 2019 03:24:29 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 7ABD0130F44 for <xml2rfc@ietf.org>; Sat, 23 Feb 2019 03:24:29 -0800 (PST)
Received: from localhost ([::1]:52587 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gxVPv-0000ny-Gr; Sat, 23 Feb 2019 03:24:27 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Sat, 23 Feb 2019 11:24:25 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/395#comment:2
Message-ID: <084.61898dd0aca1a9ccf30ee082ec03d92f@tools.ietf.org>
References: <069.35a79c47f69de241e972bc2abe6653e3@tools.ietf.org>
X-Trac-Ticket-ID: 395
In-Reply-To: <069.35a79c47f69de241e972bc2abe6653e3@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/m6MnPtZ3yPtllY5SFW-ksEbMqTY>
Subject: Re: [xml2rfc] #395 (Version_3_cli_html): html generation fails for SVG artwork
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Sat, 23 Feb 2019 11:24:31 -0000

#395: html generation fails for SVG artwork


Comment (by julian.reschke@gmx.de):

 I think, given the v3 grammar, that interpretation is clearly incorrect.

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  closed
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_html     |    Version:  2.19.*
Resolution:  invalid                |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/395#comment:2>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Sun Feb 24 13:14:59 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id CCE8C12D827 for <xml2rfc@ietfa.amsl.com>; Sun, 24 Feb 2019 13:14:57 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id ruJKuS5Xs7Fz for <xml2rfc@ietfa.amsl.com>; Sun, 24 Feb 2019 13:14:55 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 5CDD5126C15 for <xml2rfc@ietf.org>; Sun, 24 Feb 2019 13:14:55 -0800 (PST)
Received: from localhost ([::1]:35096 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gy16s-0001Wn-79; Sun, 24 Feb 2019 13:14:54 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Sun, 24 Feb 2019 21:14:54 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396
Message-ID: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-Trac-Ticket-ID: 396
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/JYe7J397g60EEDDFfnhzVkt0_xk>
Subject: [xml2rfc] #396 (Version_3_cli_html): SVG in HTML does not display
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Sun, 24 Feb 2019 21:14:58 -0000

#396: SVG in HTML does not display

 See attached XML and HTML. When displayed in browser, the SVG does not
 display.

-- 
-----------------------------------+--------------------
 Reporter:  julian.reschke@gmx.de  |      Owner:
     Type:  defect                 |     Status:  new
 Priority:  medium                 |  Milestone:
Component:  Version_3_cli_html     |    Version:  2.19.*
 Keywords:                         |
-----------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Sun Feb 24 14:55:47 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 1B35F12870E for <xml2rfc@ietfa.amsl.com>; Sun, 24 Feb 2019 14:55:45 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 6NNg4Fyr-2lB for <xml2rfc@ietfa.amsl.com>; Sun, 24 Feb 2019 14:55:43 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 3D8E1127598 for <xml2rfc@ietf.org>; Sun, 24 Feb 2019 14:55:43 -0800 (PST)
Received: from localhost ([::1]:36888 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gy2gQ-0007ZE-J5; Sun, 24 Feb 2019 14:55:42 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com
X-Trac-Project: xml2rfc
Date: Sun, 24 Feb 2019 22:55:42 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:1
Message-ID: <084.9620840339098b1feb41617690d7eeec@tools.ietf.org>
References: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-Trac-Ticket-ID: 396
In-Reply-To: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/kayJFRZmmnus4_d0pcbVgeVmJt4>
Subject: Re: [xml2rfc] #396 (Version_3_cli_html): SVG in HTML does not display
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Sun, 24 Feb 2019 22:55:45 -0000

#396: SVG in HTML does not display


Comment (by henrik@levkowetz.com):

 As far as I can tell, this is what happens:

 In the provided XML, you declare the svg namespace in the <rfc> element,
 and then _again_ in the <svg> element.  The result is that in the html
 file, the browser quite correctly is presented with this in the HTML file,
 after the top-level namespace has been moved down to the relevant element
 (note the element tag <svg:svg> with an additional svg namespace
 declaration):

 {{{
 <svg:svg xmlns:svg="http://www.w3.org/2000/svg"
 xmlns:xlink="http://www.w3.org/1999/xlink" height="55" width="380"
 viewBox="0 0 380.0 55.0">
   <svg:path d="M5.5 34 v12 m 4 0 v-12" fill="none"
 stroke="black"></svg:path>
 ...
 }}}

 instead of this, which you'd get without the nested svg namespace
 declarations (and which works fine):

 {{{
 <svg xmlns="http://www.w3.org/2000/svg" height="55" width="380">
   <path d="M5.5 34 v12 m 4 0 v-12" fill="none" stroke="black"/>
 ...
 }}}

 And as you say, browsers seem not to be too happy about that.  But with
 the given input, the output is correct, as far as I can tell.  It's just
 not what the browser is ready to deal with.

 FWIW, I don't know why you'd ever add the svg namespace declaration to the
 <rfc> element.  I'm sure you'd want to use tools to generate standalone
 svg files, and they would then always include the namespace declaration in
 the <svg> element, no?

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_html     |    Version:  2.19.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:1>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Sun Feb 24 21:17:13 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 0CE601200D8 for <xml2rfc@ietfa.amsl.com>; Sun, 24 Feb 2019 21:17:11 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id GBoI_X1iTBWI for <xml2rfc@ietfa.amsl.com>; Sun, 24 Feb 2019 21:17:09 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 4066E12D4E9 for <xml2rfc@ietf.org>; Sun, 24 Feb 2019 21:17:09 -0800 (PST)
Received: from localhost ([::1]:43573 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gy8dY-0007mU-B1; Sun, 24 Feb 2019 21:17:08 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Mon, 25 Feb 2019 05:17:08 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:2
Message-ID: <084.0b6024febb091649822f735aa9798c02@tools.ietf.org>
References: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-Trac-Ticket-ID: 396
In-Reply-To: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/WiAb2z7oL7zeR6MAsWbzqDdl1WU>
Subject: Re: [xml2rfc] #396 (Version_3_cli_html): SVG in HTML does not display
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 05:17:11 -0000

#396: SVG in HTML does not display


Comment (by julian.reschke@gmx.de):

 > In the provided XML, you declare the svg namespace in the <rfc> element,
 and then _again_ in the <svg> element.

 Yes. I can change this, but the XML definitively is valid input.

 > The result is that in the html file, the browser quite correctly is
 presented with this in the HTML file, after the top-level namespace has
 been moved down to the relevant element (note the element tag <svg:svg>
 with an additional svg namespace declaration):

 Why is it moving these namespace declarations in the first place?

 > And as you say, browsers seem not to be too happy about that. But with
 the given input, the output is correct, as far as I can tell. It's just
 not what the browser is ready to deal with.

 The validators I tried did complain as well (FWIW, they are also
 complaining a lot about the CSS...

 > FWIW, I don't know why you'd ever add the svg namespace declaration to
 the <rfc> element. I'm sure you'd want to use tools to generate standalone
 svg files, and they would then always include the namespace declaration in
 the <svg> element, no?

 It wasn't intended. But then, the inoput *is* valid (it should never be
 cause breakage do have too many namespace declarations, as long in the end
 every element ends up in the namespace where it's supposed to be).

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_html     |    Version:  2.19.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:2>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Sun Feb 24 21:21:50 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 66BC612D4E9 for <xml2rfc@ietfa.amsl.com>; Sun, 24 Feb 2019 21:21:49 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 79gteDxUgzRM for <xml2rfc@ietfa.amsl.com>; Sun, 24 Feb 2019 21:21:48 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 183F21200D8 for <xml2rfc@ietf.org>; Sun, 24 Feb 2019 21:21:48 -0800 (PST)
Received: from localhost ([::1]:43647 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gy8i3-0005sF-Qu; Sun, 24 Feb 2019 21:21:47 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Mon, 25 Feb 2019 05:21:45 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:3
Message-ID: <084.edc42e953302f61d85727cf3da79ba29@tools.ietf.org>
References: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-Trac-Ticket-ID: 396
In-Reply-To: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/ILA8mg4jsQKyqJ_fwK8pubxSLZ0>
Subject: Re: [xml2rfc] #396 (Version_3_cli_html): SVG in HTML does not display
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 05:21:49 -0000

#396: SVG in HTML does not display


Comment (by julian.reschke@gmx.de):

 So the diff to the working HTML output is:


 {{{
 < <svg:svg xmlns:svg="http://www.w3.org/2000/svg"
 xmlns:xlink="http://www.w3.org/1999/xlink" height="55" width="380"
 viewBox="0 0 380.0 55.0">
 <           <svg:path d="M5.5 34 v12 m 4 0 v-12" fill="none"
 stroke="black"></svg:path>
 <           <svg:path d="M370.5 34 v12 m 4 0 v-12" fill="none"
 stroke="black"></svg:path>
 <           <svg:path d="M127 10 l-4 3 v-6 z" fill="none"
 stroke="black"></svg:path>
 <           <svg:a xlink:href="#translation_unit">
 <             <svg:rect x="60" y="30" height="20" width="130" rx="0"
 ry="0" fill="none" stroke="black"></svg:rect>
 <             <svg:text x="125" y="45" text-
 anchor="middle">translation_unit</svg:text>
 <           </svg:a>
 <           <svg:rect x="240" y="30" height="20" width="110" rx="0" ry="0"
 fill="none" stroke="black"></svg:rect>
 <           <svg:text x="295" y="45" text-
 anchor="middle">external_decl</svg:text>
 <           <svg:path d="M40 20 v10" fill="none"
 stroke="black"></svg:path>
 <           <svg:path d="M210 30 q0 10 10 10" fill="none"
 stroke="black"></svg:path>
 <           <svg:path d="M190 40 h50" fill="none"
 stroke="black"></svg:path>
 <           <svg:path d="M30 40 q10 0 10 -10" fill="none"
 stroke="black"></svg:path>
 <           <svg:path d="M40 20 q0 -10 10 -10 h150 q10 0 10 10 v10"
 fill="none" stroke="black"></svg:path>
 <           <svg:path d="M350 40 h20" fill="none"
 stroke="black"></svg:path>
 <           <svg:path d="M10 40 h50" fill="none"
 stroke="black"></svg:path>
 <         </svg:svg>
 ---
 > <svg xmlns="http://www.w3.org/2000/svg"
 xmlns:xlink="http://www.w3.org/1999/xlink" height="55" width="380"
 viewBox="0 0 380.0 55.0">
 >           <path d="M5.5 34 v12 m 4 0 v-12" fill="none"
 stroke="black"></path>
 >           <path d="M370.5 34 v12 m 4 0 v-12" fill="none"
 stroke="black"></path>
 >           <path d="M127 10 l-4 3 v-6 z" fill="none"
 stroke="black"></path>
 >           <a xlink:href="#translation_unit">
 >             <rect x="60" y="30" height="20" width="130" rx="0" ry="0"
 fill="none" stroke="black"></rect>
 >             <text x="125" y="45" text-
 anchor="middle">translation_unit</text>
 >           </a>
 >           <rect x="240" y="30" height="20" width="110" rx="0" ry="0"
 fill="none" stroke="black"></rect>
 >           <text x="295" y="45" text-anchor="middle">external_decl</text>
 >           <path d="M40 20 v10" fill="none" stroke="black"></path>
 >           <path d="M210 30 q0 10 10 10" fill="none"
 stroke="black"></path>
 >           <path d="M190 40 h50" fill="none" stroke="black"></path>
 >           <path d="M30 40 q10 0 10 -10" fill="none"
 stroke="black"></path>
 >           <path d="M40 20 q0 -10 10 -10 h150 q10 0 10 10 v10"
 fill="none" stroke="black"></path>
 >           <path d="M350 40 h20" fill="none" stroke="black"></path>
 >           <path d="M10 40 h50" fill="none" stroke="black"></path>
 >         </svg>

 }}}

 The problem is that xml2rfc apparently prefixes the HTML <svg> element
 with the XML namespace declaration from the source file, if present.
 That's IMHO a bug (HTML is not XML, and they are picky about the way
 namespace declarations for SVG are allowed).

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_html     |    Version:  2.19.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:3>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Sun Feb 24 21:37:10 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id ED404130DD3 for <xml2rfc@ietfa.amsl.com>; Sun, 24 Feb 2019 21:37:08 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id UAvesLqFNNA0 for <xml2rfc@ietfa.amsl.com>; Sun, 24 Feb 2019 21:37:07 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id BA17C126F72 for <xml2rfc@ietf.org>; Sun, 24 Feb 2019 21:37:07 -0800 (PST)
Received: from localhost ([::1]:43913 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gy8wt-0005yQ-7i; Sun, 24 Feb 2019 21:37:07 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Mon, 25 Feb 2019 05:37:07 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:4
Message-ID: <084.a9ca3c6ba6252602c78e73a0ea817f92@tools.ietf.org>
References: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-Trac-Ticket-ID: 396
In-Reply-To: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/bcV6zaMCGXAxUfXqnxQ8vP9cmYs>
Subject: Re: [xml2rfc] #396 (Version_3_cli_html): SVG in HTML does not display
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 05:37:09 -0000

#396: SVG in HTML does not display


Comment (by julian.reschke@gmx.de):

 FWIW, this might indicate that we should have a normalization step for
 namespace declarations in the prep stage (but I'm not yet sure about it).

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_html     |    Version:  2.19.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:4>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Sun Feb 24 23:52:03 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 205E2130ED7 for <xml2rfc@ietfa.amsl.com>; Sun, 24 Feb 2019 23:52:02 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id V39zHcGPxRtN for <xml2rfc@ietfa.amsl.com>; Sun, 24 Feb 2019 23:52:00 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 85C3F130ED4 for <xml2rfc@ietf.org>; Sun, 24 Feb 2019 23:52:00 -0800 (PST)
Received: from localhost ([::1]:46439 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gyB3P-0006gn-S2; Sun, 24 Feb 2019 23:51:59 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 8bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Mon, 25 Feb 2019 07:51:59 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:5
Message-ID: <084.9375074e8f8dc9fcf462e043d2e27825@tools.ietf.org>
References: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-Trac-Ticket-ID: 396
In-Reply-To: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/AEO1Z38vS1l3l0aKoN7QlBb0IE8>
Subject: Re: [xml2rfc] #396 (Version_3_cli_html): SVG in HTML does not display
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 07:52:02 -0000

#396: SVG in HTML does not display


Comment (by henrik@levkowetz.com):

 Replying to [comment:2 julian.reschke@…]:

 >
 > Why is it moving these namespace declarations in the first place?

 Because there's a namespace normalization step after the v2v3 conversion.
 You can avoid your XML going through the v2v3 conversion by setting
 version="3" on the <rfc> element.

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_html     |    Version:  2.19.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:5>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Mon Feb 25 00:56:20 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 2C408130EEB for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 00:56:18 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 5eHCcCPq0XFZ for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 00:56:16 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 3518F130EE7 for <xml2rfc@ietf.org>; Mon, 25 Feb 2019 00:56:16 -0800 (PST)
Received: from localhost ([::1]:47760 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gyC3b-00067Z-0C; Mon, 25 Feb 2019 00:56:15 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Mon, 25 Feb 2019 08:56:13 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:6
Message-ID: <084.e786173dd3846774e56990becc7fe404@tools.ietf.org>
References: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-Trac-Ticket-ID: 396
In-Reply-To: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/Q2rYd0-C3hYOV5l7TZ3Ei3oi6ho>
Subject: Re: [xml2rfc] #396 (Version_3_cli_html): SVG in HTML does not display
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 08:56:18 -0000

#396: SVG in HTML does not display


Comment (by julian.reschke@gmx.de):

 Indeed.

 So it's a problem in the v2-v3 namespace normalization. Why is there any
 anyway, given the fact that valid v2 documents do not use any namespaces
 in the first place?

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_html     |    Version:  2.19.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:6>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Mon Feb 25 00:57:16 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 1C044130EED for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 00:57:15 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id oJAsctIq3aXl for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 00:57:13 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 41D90130EE7 for <xml2rfc@ietf.org>; Mon, 25 Feb 2019 00:57:13 -0800 (PST)
Received: from localhost ([::1]:47773 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gyC4W-0000Th-Iy; Mon, 25 Feb 2019 00:57:12 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Mon, 25 Feb 2019 08:57:12 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:7
Message-ID: <084.335b665355fc685f8a37a89496a872e8@tools.ietf.org>
References: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-Trac-Ticket-ID: 396
In-Reply-To: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/p4ZVei1LzEYmG9xF4UlRHzpSr9Y>
Subject: Re: [xml2rfc] #396 (Version_3_cli_html): SVG in HTML does not display (depending on namespace decls) (was: SVG in HTML does not display)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 08:57:15 -0000

#396: SVG in HTML does not display (depending on namespace decls)


-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_html     |    Version:  2.19.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:7>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Mon Feb 25 03:41:53 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id ECC78130EDF for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 03:41:51 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id A_FZboU6Lbew for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 03:41:50 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 1B963130DC9 for <xml2rfc@ietf.org>; Mon, 25 Feb 2019 03:41:50 -0800 (PST)
Received: from localhost ([::1]:51769 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gyEdo-0008G1-V1; Mon, 25 Feb 2019 03:41:48 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 8bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Mon, 25 Feb 2019 11:41:47 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:8
Message-ID: <084.19de546ffe41801c3a874294cb4f2828@tools.ietf.org>
References: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-Trac-Ticket-ID: 396
In-Reply-To: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/2SNQJjsR3Y1s47Ftgn0kHMUGz0o>
Subject: Re: [xml2rfc] #396 (Version_3_cli_html): SVG in HTML does not display (depending on namespace decls)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 11:41:52 -0000

#396: SVG in HTML does not display (depending on namespace decls)


Comment (by henrik@levkowetz.com):

 Replying to [comment:6 julian.reschke@…]:
 > Indeed.
 >
 > So it's a problem in the v2-v3 namespace normalization. Why is there any
 anyway, given the fact that valid v2 documents do not use any namespaces
 in the first place?

 There's no guarantees about what gets fed into the v2v3 converter.

 If the incoming XML is marked as version="3", then it goes around the
 converter.

 But if it's not so marked, it goes through the converter to guarantee that
 what's fed to the preptool and the formatters is v3 without any deprecated
 elements.  What goes into the v2v3 converter could thus be anything from
 100% v2, to an unholy mix of new v3 elements and deprecated v2 elements,
 to 100% v3 (but missing the version="3" attribute).  No way to tell ahead
 of time.

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_html     |    Version:  2.19.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:8>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Mon Feb 25 03:47:10 2019
Return-Path: <chopps@chopps.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 4A67112F295 for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 03:47:09 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_NONE=-0.0001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id hgKRDnJWx7-9 for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 03:47:08 -0800 (PST)
Received: from smtp.chopps.org (smtp.chopps.org [54.88.81.56]) by ietfa.amsl.com (Postfix) with ESMTP id 4B2D41200B3 for <xml2rfc@ietf.org>; Mon, 25 Feb 2019 03:47:08 -0800 (PST)
Received: from tops.chopps.org (047-050-069-038.biz.spectrum.com [47.50.69.38]) (using TLSv1.2 with cipher AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by smtp.chopps.org (Postfix) with ESMTPS id BD425604D1; Mon, 25 Feb 2019 06:47:07 -0500 (EST)
User-agent: mu4e 1.1.0; emacs 26.1
From: Christian Hopps <chopps@chopps.org>
To: XML2RFC Interest Group <xml2rfc@ietf.org>
Cc: chopps@chopps.org
Date: Mon, 25 Feb 2019 06:47:06 -0500
Message-ID: <sa6d0ngf5tx.fsf@chopps.org>
MIME-Version: 1.0
Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature"
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/WpbUk7RtbBdpey0cMkv7aLH9gqE>
Subject: [xml2rfc] only fullname fails in references.
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 11:47:09 -0000

--=-=-=
Content-Type: text/plain; format=flowed


If one has only the 'fullname' attribute set on 'author' tags in references, the author is not listed in the reference. For the document authors one is not required to list 'initials' or 'surname' attributes for the correct thing to happen. I think this is a bug, as the code should be able to re-use the method it has for document authors to generate initials and surname values.

Thanks,
Chris.

--=-=-=
Content-Type: application/pgp-signature; name="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCgAdFiEEm56yH/NF+m1FHa6lLh2DDte4MCUFAlxz1boACgkQLh2DDte4
MCXEMBAAlvhwzO8fJjlZcLwY5CXgRhQtuUJ7yJEgCyppaae3nQKbpLqTsgnvX0bp
zpFKDg+RHbjSvNDtMd0vGQ3X0+bmILK4zffj3c7WiZUADEDDUihHuQf0XHun3On8
YlAoT7mZfFbEIEUOKTfkS/cvycwmDI6TnnY6nbdowMqGifQYjlJGFOg1JcHNuAsr
7JmqusphZYYZpDdYhvM3oz0QTuh1zEvbPZWcsUSm5KQPHMN/Ha6nfcoJnFTx0CCm
mpPz2puAFb8vbch0zHEMeEzgXyyRl9lOKDMZkMpzofJi8KcaUSdznpowq8JoFczn
Kel7pTDlzHf0z9+xvm8ep97Z7muf2PIw5FWCXw6/9P1wvXYJJ+HETSzXjLqLdti1
7XQKPVxIyJDnRg1GKi7sJizQtvJ+IRIzQ9Q262y9Fr2WoOXOFUTw4o1FdvaUagBI
lkSqFB5+vA0bhJXQUriRVhLjaeYs0Iauz0ABgEVU3ap9qlGf4D6126Bc14VcJMsK
eFrZsdQyVHk9iVNS1kRo3JqfGFWpFU2AEryoPyNiy2vz0J81zLRFQ1myie+1xXaX
ZM79vu/37s9PxQFvd1/jXDRhwKMywMoznyrfjUR5EFqocE/96q4AGDZfqB/vWCuc
mNpv7ePI/4NV0FgE4SpbM0pHDzLRgj8aPyGHuHDH9EiY6JMZ5sg=
=vua1
-----END PGP SIGNATURE-----
--=-=-=--


From nobody Mon Feb 25 03:47:59 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 578BE130ED7 for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 03:47:58 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id R2CtOplIZbFJ for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 03:47:56 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id D3E52130DC9 for <xml2rfc@ietf.org>; Mon, 25 Feb 2019 03:47:56 -0800 (PST)
Received: from localhost ([::1]:51925 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gyEjk-0008Gi-Fp; Mon, 25 Feb 2019 03:47:56 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Mon, 25 Feb 2019 11:47:56 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:9
Message-ID: <084.caf797203f75b0fb679aec5b7c826db4@tools.ietf.org>
References: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-Trac-Ticket-ID: 396
In-Reply-To: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/pBvYpaT55eupCX_2SIjoe5Y76Jc>
Subject: Re: [xml2rfc] #396 (Version_3_cli_html): SVG in HTML does not display (depending on namespace decls)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 11:47:59 -0000

#396: SVG in HTML does not display (depending on namespace decls)


Comment (by julian.reschke@gmx.de):

 >  What goes into the v2v3 converter could thus be anything from 100% v2,
 to an unholy mix of new v3 elements and deprecated v2 elements

 Cool, I wasn't aware of that.

 This still leaves the question why the namespace normalization creates
 something that the v3 backend can't process. That's a bug, right?

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_html     |    Version:  2.19.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:9>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Mon Feb 25 04:16:48 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id B8944130E64 for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 04:16:46 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id gDRxFKipzVnC for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 04:16:44 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id D26F712D4E6 for <xml2rfc@ietf.org>; Mon, 25 Feb 2019 04:16:44 -0800 (PST)
Received: from localhost ([::1]:52704 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gyFBc-0008EI-0X; Mon, 25 Feb 2019 04:16:44 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Mon, 25 Feb 2019 12:16:41 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:10
Message-ID: <084.0e62f8be88960bf2ee2f9ca5aee9c83f@tools.ietf.org>
References: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-Trac-Ticket-ID: 396
In-Reply-To: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/GTrinizD_QXrGH1wx5OqiKJRfcs>
Subject: Re: [xml2rfc] #396 (Version_3_cli_html): SVG in HTML does not display (depending on namespace decls)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 12:16:47 -0000

#396: SVG in HTML does not display (depending on namespace decls)


Comment (by henrik@levkowetz.com):

 The v3 backend processes it just fine.  What comes out is actually exactly
 what you sent in, although with the namespace declaration re-arranged
 (moved from top to <svg> elemnt) as part of the final html serialization.

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_html     |    Version:  2.19.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:10>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Mon Feb 25 04:22:42 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 8EFBD130E64 for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 04:22:40 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id Fj3jVjwhlQBK for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 04:22:39 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 36FFF1271FF for <xml2rfc@ietf.org>; Mon, 25 Feb 2019 04:22:39 -0800 (PST)
Received: from localhost ([::1]:52882 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gyFHK-0002Yt-RI; Mon, 25 Feb 2019 04:22:38 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Mon, 25 Feb 2019 12:22:38 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:11
Message-ID: <084.986439dd06bc4c5359a37b5ceb7c0e43@tools.ietf.org>
References: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-Trac-Ticket-ID: 396
In-Reply-To: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/20_FQMP8TRkvew1tuNS6F8jlG3w>
Subject: Re: [xml2rfc] #396 (Version_3_cli_html): SVG in HTML does not display (depending on namespace decls)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 12:22:41 -0000

#396: SVG in HTML does not display (depending on namespace decls)


Comment (by julian.reschke@gmx.de):

 Well, the input is valid rfcxml, the output is invalid HTML5. So I don't
 see how you can not consider this a bug...

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_html     |    Version:  2.19.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:11>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Mon Feb 25 04:28:01 2019
Return-Path: <julian.reschke@gmx.de>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id AC8E8130E64 for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 04:28:00 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -2.601
X-Spam-Level: 
X-Spam-Status: No, score=-2.601 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, FREEMAIL_FROM=0.001, RCVD_IN_DNSWL_LOW=-0.7, RCVD_IN_MSPIKE_H2=-0.001, SPF_PASS=-0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 2zz4bhgMfFpD for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 04:27:59 -0800 (PST)
Received: from mout.gmx.net (mout.gmx.net [212.227.17.21]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id B65FC1271FF for <xml2rfc@ietf.org>; Mon, 25 Feb 2019 04:27:58 -0800 (PST)
Received: from [192.168.178.124] ([91.61.62.225]) by mail.gmx.com (mrgmx101 [212.227.17.168]) with ESMTPSA (Nemesis) id 0Ls8Qd-1h9Kje3eUZ-013wZC; Mon, 25 Feb 2019 13:27:53 +0100
To: Christian Hopps <chopps@chopps.org>, XML2RFC Interest Group <xml2rfc@ietf.org>
References: <sa6d0ngf5tx.fsf@chopps.org>
From: Julian Reschke <julian.reschke@gmx.de>
Message-ID: <8672703b-4f37-e7cb-76ac-99297d4996b2@gmx.de>
Date: Mon, 25 Feb 2019 13:27:54 +0100
User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; rv:60.0) Gecko/20100101 Thunderbird/60.5.1
MIME-Version: 1.0
In-Reply-To: <sa6d0ngf5tx.fsf@chopps.org>
Content-Type: text/plain; charset=utf-8; format=flowed
Content-Language: en-US
Content-Transfer-Encoding: 7bit
X-Provags-ID: V03:K1:namB9pvTpeYnb7aBKiaxVmi4aGIsBQqcmm0NBWm8L02dgJUIaxX enQck+t6k9kNU9no8Jqz6Er8YA3ZlTe+VbbTvXzKl6tCAl92N94ddZ9XbgRibhmpdRWwpug O9thS8Oanrxs8yMAFK4X7ARo5hoCRSM52ME0U9+a/6m98Q2g2VrVTG0h91hdW6nb8baaEU+ iliecbqWJOey5cZfgMd4Q==
X-UI-Out-Filterresults: notjunk:1;V03:K0:Xw1Rto+go/A=:2fubqzuYfbr76cF0kOC6+h 80P6enI0w5oy61vYePsGfgPh6V4Psdk9odNnvF5h9/NkFL9Frn9SjXPi1m7unZERZhJ0mIrWO vJSSPBEFAhPtI9ltVtYLVunNenLavMfgDBx4f/Sbtzz17HxJiJ2OdwdUjsoa5LAXHiAv5MA/l +Uy+00nCbr/nJsmXldkdZez9j2zwloq6OVVO0hb7q0oliVnV+I8ARCGuCZqL2NA4QinvFjEhf 31+QKJs2gT2WTy0Nm1K3EVXXUGhxMd6np87C9jeoxEEZATfOI0/hH6Awj9MNQ2o7zL2otjfZZ G1865GDvZOxMt2UETbEdpuyrgrWChtE8kE5Tx35RAGogB5+1AptHfa0cm1zRPxEyD3wT+0T8n GuvuPL9OJeqMY3NMm/AYJWfm6Zwune9BSXIqTClgsWe4vzQzx4my57oy9t5JPqdjeGHxur/fA p6IFgvTRPYmDsdo/yYH4BWt69aQBDL7mIj7tSrSch6aqld+AGpDO1mVxmwp6y5YYzhFOOtkf/ qhyQoMqd/K6vpaFBxRyb0cZ9YDhK6p90Y+4Y3EjAOlNSzCTLStRPc/JEko2vffIe3ZvHHKh4p NZXdEUfmLRFcSC8SJKdAZa1VFSE6iWs9gOMdYps2T9stOj9QYdP/N5G1ICSkJVEEbT3oxnCMy ohSok3ccq0zMNgJ3i3quZefSv7pC1vUrMoOCiftfwqnfzk4UDQeMA55tPmnG3Vl4mmBqn+pPP xBD71IOmlOGoPN6K4zMcAp+9bvwkt3gEAUIyzSbUP49cZS7paQ2nPGzcMtqL7mcP0g6uMu1Mq XsNWLvmU268TpQ2vjp4lWGAFz4rIXEiVDC0wXBvsNhwomh/WWMaFesq6VgnMCgNMB/Ix1DLu1 NEw4tWa4NzdrFA5j7IUkS6keTSPXZSSCew4Tj2fuFUX7bFt44xngS1Vw/f40qik0AIqjh9Nxw rPmAQjf1hzQ==
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/B7Fp4bDEn_w53OxAtfpTO10RaWc>
Subject: Re: [xml2rfc] only fullname fails in references.
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 12:28:01 -0000

On 25.02.2019 12:47, Christian Hopps wrote:
> 
> If one has only the 'fullname' attribute set on 'author' tags in 
> references, the author is not listed in the reference. For the document 
> authors one is not required to list 'initials' or 'surname' attributes 
> for the correct thing to happen. I think this is a bug, as the code 
> should be able to re-use the method it has for document authors to 
> generate initials and surname values.

As far as I understand, there is no reliable code to do that, otherwise 
we wouldn't need the additional attributes in the first place.

I think it's ok for an processor to skip incomplete entries, but it 
would be good to generate a warning message.

Best regards, Julian


From nobody Mon Feb 25 04:45:20 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 666D5130EF1 for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 04:45:18 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id E37jzqBokW8w for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 04:45:16 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id A8C67130EED for <xml2rfc@ietf.org>; Mon, 25 Feb 2019 04:45:16 -0800 (PST)
Received: from localhost ([::1]:53582 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gyFdC-0004Si-SA; Mon, 25 Feb 2019 04:45:14 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Mon, 25 Feb 2019 12:45:14 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:12
Message-ID: <084.a28d215d015ddc4337ff5e6312a4e109@tools.ietf.org>
References: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-Trac-Ticket-ID: 396
In-Reply-To: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/aO8YS7Grf6dvPPYD76TP3Umaps4>
Subject: Re: [xml2rfc] #396 (Version_3_cli_html): SVG in HTML does not display (depending on namespace decls)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 12:45:18 -0000

#396: SVG in HTML does not display (depending on namespace decls)


Comment (by henrik@levkowetz.com):

 I think the only way to avoid this kind of namespace bugs would be to
 reject input with namespace declarations in the root element, in that
 case.  Otherwise I'm afraid you could always design an input (like this
 one) that will make browsers happy, even if it is perfectly correct from
 an xml viewpoint.

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_html     |    Version:  2.19.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:12>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Mon Feb 25 05:02:08 2019
Return-Path: <chopps@chopps.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id DCC78130F73 for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 05:02:01 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_NONE=-0.0001, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id grMrCNCaVLf4 for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 05:01:55 -0800 (PST)
Received: from smtp.chopps.org (smtp.chopps.org [54.88.81.56]) by ietfa.amsl.com (Postfix) with ESMTP id 86772130F55 for <xml2rfc@ietf.org>; Mon, 25 Feb 2019 05:01:55 -0800 (PST)
Received: from tops.chopps.org (047-050-069-038.biz.spectrum.com [47.50.69.38]) (using TLSv1.2 with cipher AES256-GCM-SHA384 (256/256 bits)) (Client did not present a certificate) by smtp.chopps.org (Postfix) with ESMTPS id 0A08C604D1; Mon, 25 Feb 2019 08:01:54 -0500 (EST)
References: <sa6d0ngf5tx.fsf@chopps.org> <8672703b-4f37-e7cb-76ac-99297d4996b2@gmx.de>
User-agent: mu4e 1.1.0; emacs 26.1
From: Christian Hopps <chopps@chopps.org>
To: Julian Reschke <julian.reschke@gmx.de>
Cc: Christian Hopps <chopps@chopps.org>, XML2RFC Interest Group <xml2rfc@ietf.org>
In-reply-to: <8672703b-4f37-e7cb-76ac-99297d4996b2@gmx.de>
Date: Mon, 25 Feb 2019 08:01:54 -0500
Message-ID: <sa67edof2d9.fsf@chopps.org>
MIME-Version: 1.0
Content-Type: multipart/signed; boundary="=-=-="; micalg=pgp-sha512; protocol="application/pgp-signature"
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/y2nYe7lvHyToch_g1NTM61DH9uo>
Subject: Re: [xml2rfc] only fullname fails in references.
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 13:02:06 -0000

--=-=-=
Content-Type: text/plain; format=flowed


Julian Reschke <julian.reschke@gmx.de> writes:

> On 25.02.2019 12:47, Christian Hopps wrote:
>>
>> If one has only the 'fullname' attribute set on 'author' tags in references,
>> the author is not listed in the reference. For the document authors one is not
>> required to list 'initials' or 'surname' attributes for the correct thing to
>> happen. I think this is a bug, as the code should be able to re-use the method
>> it has for document authors to generate initials and surname values.
>
> As far as I understand, there is no reliable code to do that, otherwise we
> wouldn't need the additional attributes in the first place.

But it works fine for the document author tags so there must be code in there to do this.

There's reason for the attributes even with auto-generation -- it could be that one does not like the auto-generation results. For example I prefer my abbreviated name to appear as "C. Hopps" (not "C. E. Hopps"), but at least in the past have listed my full name as "Christian E. Hopps".

Thanks,
Chris.

> I think it's ok for an processor to skip incomplete entries, but it would be
> good to generate a warning message.
>
> Best regards, Julian


--=-=-=
Content-Type: application/pgp-signature; name="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCgAdFiEEm56yH/NF+m1FHa6lLh2DDte4MCUFAlxz50IACgkQLh2DDte4
MCVJQBAAhgYFAONnS651brdjLKDCq/OLNDSDdj/0nyWFRcJ7g2iwXgYG646qjxHh
n+jxiVsoqve/FCFeNXt0U1lefCijCqGU02qtVhXJHTxp0gvDPEOg0GPdQrY4sqU9
fwUXaREPZKnPAgQqhyJCarIqrPv7B+WqO2HhxPonRbkf5oca1N5+6zEfUFzoX6tu
VbF44X/qXtZ1aLVZbqKClGYHhRXihqKIB6CYIXiBVRYyZqdOc1EHUtYsFEESh02o
2WN1Mvfg+oMbv/RhQr4OtZcNKU7u4UArA/7GOJfBBSQ8+3MXSmqVh7OMLWGJV/gc
+PokLV1ze4aUvHYW1AGQ+6yLQPBTsuQINAQuLXxuqe8wclNfKPi9L/+eOAjEz9at
Ry+zv1u4XuwBlD51399ZJ4A4vulFRWgGMAzNoGwV23mJA7csrsnwPjZH7aT/Da0Q
fQ3STDAKqidgHW8k+5yS30O7mxfCz3k2TpTXKDnEYpyOk/kc0Aw5fBmJLe+44uOB
vRU/6OMLDgDMYxG7+OTx/IN7Wei4o29PvOtWNZQTZkJ1lnxXLVsoc+3BnIAMRyIW
meUyR/NrvfZkLkjSJDUlBXnazG0owUKSbCuvXHPpIxgj2vcrmM5pGQ8uFGsNnncP
9+dkj9WPhQaQ7WNyrbJ8wrLw1rsx6fiRjOxEMe7BEIO3vDQnIXI=
=+I3N
-----END PGP SIGNATURE-----
--=-=-=--


From nobody Mon Feb 25 05:03:45 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 72A32130EF1 for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 05:03:43 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 2V80zhElUHin for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 05:03:41 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 4F4DA130EED for <xml2rfc@ietf.org>; Mon, 25 Feb 2019 05:03:41 -0800 (PST)
Received: from localhost ([::1]:54043 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gyFv2-0002Ui-P4; Mon, 25 Feb 2019 05:03:40 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Mon, 25 Feb 2019 13:03:40 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:13
Message-ID: <084.ea1512528a1ebdeeb431e145a9f3a208@tools.ietf.org>
References: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-Trac-Ticket-ID: 396
In-Reply-To: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/gGVdtxBMGBwp4ksuyD9ZqDWmQEM>
Subject: Re: [xml2rfc] #396 (Version_3_cli_html): SVG in HTML does not display (depending on namespace decls)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 13:03:43 -0000

#396: SVG in HTML does not display (depending on namespace decls)


Comment (by julian.reschke@gmx.de):

 It's not the input that makes the browser unhappy, it's the output.

 In this case, just stripping the namespace decl on the root element
 suffices, right?

 I see that there can be more complex cases, but until proven wrong, I'll
 claim that they all can be handled in the code.

 FWIW, for now, the only place where xmlns declarations in HTML output are
 supposed to appear is on the SVG elements or it's descendants. That's
 relatively easy to enforce.

 rfc2629.xslt doesn't handle this explicitly yet, but I'm happy to draft
 code that does if you provide an example that you think is hard.

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_html     |    Version:  2.19.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:13>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Mon Feb 25 05:05:47 2019
Return-Path: <julian.reschke@gmx.de>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 396E6130EFC for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 05:05:46 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -2.601
X-Spam-Level: 
X-Spam-Status: No, score=-2.601 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, FREEMAIL_FROM=0.001, RCVD_IN_DNSWL_LOW=-0.7, RCVD_IN_MSPIKE_H2=-0.001, SPF_PASS=-0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id Kj--MIoCwLSk for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 05:05:44 -0800 (PST)
Received: from mout.gmx.net (mout.gmx.net [212.227.17.20]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 5E252130EF1 for <xml2rfc@ietf.org>; Mon, 25 Feb 2019 05:05:44 -0800 (PST)
Received: from [192.168.178.124] ([91.61.62.225]) by mail.gmx.com (mrgmx103 [212.227.17.168]) with ESMTPSA (Nemesis) id 0MYfJW-1gSpBx1JLO-00VNLn; Mon, 25 Feb 2019 14:05:39 +0100
To: Christian Hopps <chopps@chopps.org>
Cc: XML2RFC Interest Group <xml2rfc@ietf.org>
References: <sa6d0ngf5tx.fsf@chopps.org> <8672703b-4f37-e7cb-76ac-99297d4996b2@gmx.de> <sa67edof2d9.fsf@chopps.org>
From: Julian Reschke <julian.reschke@gmx.de>
Message-ID: <1b2229ad-3453-e0f3-f6b2-3aae36e7362a@gmx.de>
Date: Mon, 25 Feb 2019 14:05:39 +0100
User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; rv:60.0) Gecko/20100101 Thunderbird/60.5.1
MIME-Version: 1.0
In-Reply-To: <sa67edof2d9.fsf@chopps.org>
Content-Type: text/plain; charset=utf-8; format=flowed
Content-Language: en-US
Content-Transfer-Encoding: 7bit
X-Provags-ID: V03:K1:l7DCmKXlQIKQi9QYCUjZOxaxlv3JkPyfZYz0JXyG9/NCslW7Api 7DDRX8y7Je8ds+cgg9ev7Aoty99yZm8qRhu7mOMnebgdyZs+TiPpxuZ/FFvHw1pI7jGHefY HBABWOJnG/FODYyizZqASmffbfAgrv5XVb94x3sJxa6iW/4cgXNOYSq/ok0fLp/u4TmgFD1 3ezKZ6jahgyFGPMmPGzWw==
X-UI-Out-Filterresults: notjunk:1;V03:K0:5AL9lASS6gk=:Qq4edCbD7R+OxlU0VB70s9 Lo5cZwca8X6BuctLDfojuAvYR1zt7xJBJMGP/h+MRpYI4sW5eTKtGkcgwD4VstHR9yGq3yYXx 0i/uPJw5K0d+QOzRezWc5rb1Pv9KUywGDT1M013wGJusiz2VUP95N1ACsoOce9SLDBznWZGfx O4JUYINdVvKxZLxQhJv3snH0NEnfdwwvDsz0RWwvw/X+LRP/IQj5w3OKX/UfVUMOqTvgtLVpr UwLCQIZ0xHFzHBMR1MAjD+ZwRb1Lw6GU0hc+zj67vagRQvTYcEAjV6ywNawlzpY8YrtQzwInt cHRoGCcDtWxKlnWPWcuisZJzQNuqzORnInvPkfoghH824Sf1+4izUP5KbbDQFMGspT3j0n28F 1jK29vLt/72/8uOuWALO3ptYxi2502Wexfhg9f5RqEkKWIRtynbWDKRsfV30Y6jh9hIUmd2AP cnENke01OTWFGRruSqhR3HrvRfSTsbcQc6IjBoBNpHPIRetSUQkX6ndCDec3+4lwAFZwBis7u LJ+L8Nx2XT+WJnRDGlzjWMj1lFEE2s/j8an1IscmwoptPxh4l063Q3nDmuABSbaIsQkGt7rga 9fOfcyhiXT0naczq7UBjvUx9j6uwFWYG5Qa+rrFr4Oe089VemVGv6/pUMdyJJtpUCVhhesEu+ Vd931MpB0znkGREJVuUXL+Hjy5hDRasZrzaJ5OV526imnOxHwqqs4sPVOFV8vNzK4q8fccZBi xUaO7XR3TB5rq4EaisM9Ku3J/INbqLL7gpoP6rv8gffZ/GBSx1Q7vQ0FR+sNBWiaN1Uk+fQqf eenG3XwiMKA3oNS/8uwzJxka5uPn335tDpqufxlPzeUO/yux6oh3xUVwVYDRKGjmAk2sQAV0e S7JF7W83glBCwYlSZeZfmpQi4xfXmRQ40g9XcWy+n1ElOTL+CqavuaGkcJzSoK4eq4jXCcSDP yvsp2ZicTKQ==
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/Re7Zh7oUk8Vuzae0OOqJ-8yzPKU>
Subject: Re: [xml2rfc] only fullname fails in references.
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 13:05:46 -0000

On 25.02.2019 14:01, Christian Hopps wrote:
> ...
> But it works fine for the document author tags so there must be code in 
> there to do this.

I wasn't aware of that. I'll claim that this is a non-feature, because 
it's not going to work properly in general.

> There's reason for the attributes even with auto-generation -- it could 
> be that one does not like the auto-generation results. For example I 

...or that they are completely incorrect, such as by missing up family 
name and given name.

> prefer my abbreviated name to appear as "C. Hopps" (not "C. E. Hopps"), 
> but at least in the past have listed my full name as "Christian E. Hopps".
> ...

Best regards, Julian


From nobody Mon Feb 25 05:06:59 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 871FA130EFC for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 05:06:57 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id ODETj4j8YC8g for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 05:06:56 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 2D6DE130EED for <xml2rfc@ietf.org>; Mon, 25 Feb 2019 05:06:56 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:52414 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gyFyB-0001iY-BP; Mon, 25 Feb 2019 05:06:55 -0800
To: Christian Hopps <chopps@chopps.org>
References: <sa6d0ngf5tx.fsf@chopps.org> <8672703b-4f37-e7cb-76ac-99297d4996b2@gmx.de> <sa67edof2d9.fsf@chopps.org>
Cc: XML2RFC Interest Group <xml2rfc@ietf.org>
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <4e563e84-a106-f27b-702f-3929d3dd942f@levkowetz.com>
Date: Mon, 25 Feb 2019 14:06:47 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <sa67edof2d9.fsf@chopps.org>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="Xf1mp6smGL6cicu840I0q8KRLaNgf9NBO"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, chopps@chopps.org
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/oKHX27sWiYvcH2x2b_EwuWzX4fU>
Subject: Re: [xml2rfc] only fullname fails in references.
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 13:06:57 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--Xf1mp6smGL6cicu840I0q8KRLaNgf9NBO
Content-Type: multipart/mixed; boundary="s9c3CtBExBL7OXck7TbGJmxaunVlEsr3w";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Christian Hopps <chopps@chopps.org>
Cc: XML2RFC Interest Group <xml2rfc@ietf.org>
Message-ID: <4e563e84-a106-f27b-702f-3929d3dd942f@levkowetz.com>
Subject: Re: [xml2rfc] only fullname fails in references.
References: <sa6d0ngf5tx.fsf@chopps.org>
 <8672703b-4f37-e7cb-76ac-99297d4996b2@gmx.de> <sa67edof2d9.fsf@chopps.org>
In-Reply-To: <sa67edof2d9.fsf@chopps.org>

--s9c3CtBExBL7OXck7TbGJmxaunVlEsr3w
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable

Hi Chris,

On 2019-02-25 14:01, Christian Hopps wrote:
>=20
> Julian Reschke <julian.reschke@gmx.de> writes:
>=20
>> On 25.02.2019 12:47, Christian Hopps wrote:
>>>
>>> If one has only the 'fullname' attribute set on 'author' tags in refe=
rences,
>>> the author is not listed in the reference. For the document authors o=
ne is not
>>> required to list 'initials' or 'surname' attributes for the correct t=
hing to
>>> happen. I think this is a bug, as the code should be able to re-use t=
he method
>>> it has for document authors to generate initials and surname values.
>>
>> As far as I understand, there is no reliable code to do that, otherwis=
e we
>> wouldn't need the additional attributes in the first place.
>=20
> But it works fine for the document author tags so there must be code
> in there to do this.
>=20
> There's reason for the attributes even with auto-generation -- it
> could be that one does not like the auto-generation results. For
> example I prefer my abbreviated name to appear as "C. Hopps" (not "C.
> E. Hopps"), but at least in the past have listed my full name as
> "Christian E. Hopps".

Right.

This sounds like a bug.  It may be fixed in the --v3 formatters, though.
I'll investigate further.

Best regards,

	Henrik


--s9c3CtBExBL7OXck7TbGJmxaunVlEsr3w--

--Xf1mp6smGL6cicu840I0q8KRLaNgf9NBO
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlxz6GgACgkQTptXS4+7
Fxr2OA/+O3p7riz6kMcNTW783CGH6RN3Uy9vIP4zm0Avi9Knv/bXxnVlnGSgWvYb
kO3gCI5iBqua06VXxXHb/SFJgVJXkM3sAKfsJzS+zTR43EJYDfgEKkgoixho3Yeh
Z0meIAolRkCu35IfEHzRJhqZqUdOmBBNaGVBY/cq+Mxr4v0dP2krUaV2bN5RWsKR
Emoytm2Q2uPKvqWJPWkJdHIHPur3HZLCvynLSyT0OWZfu5D7oxRblfLoBFqRdLMa
GZWBxAsLBPhaNqKuvIpANCDc2OPYh0v9QQjgpE5BN5o8HZ98AKOb3iBFvkTVCYU+
hpT6/q5H56iaiCxoRPoJ78K/rYGx0vA6IC6DfGARd7ZxsOnc5zd/fY52Ov2SqiA1
DLMRfMvA1ZGGi3t/SbaiqoOsV3SCifknqV8SOotBBvBy3I5qIOZI38b/oIl99lh5
utrK9yEgLx9FvDkmypcQombO3tqlOZKbWquopyw25JHpArEt81okiZLhNzDcADz1
T4aAiZ5vUISHyx/CfUjhO5EEAYuO2nHeEvL7eRTdg0b7/ZNYg1Ng5AV39UINv2Qs
19xnDogFBJvzk4jAeImLYF/hE/6QN5SHSMu9hApX+nUX9Z33jW+KMeOyczrLEHFh
7BZAFmhrttitlOcirtEjtB80pZlh5WejpYbVcEXenMOMpp3fgxI=
=NKQ4
-----END PGP SIGNATURE-----

--Xf1mp6smGL6cicu840I0q8KRLaNgf9NBO--


From nobody Mon Feb 25 05:10:11 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id F3523130EFC for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 05:10:09 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id i-dKzJiWRVpm for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 05:10:08 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id B7FFD130EED for <xml2rfc@ietf.org>; Mon, 25 Feb 2019 05:10:08 -0800 (PST)
Received: from localhost ([::1]:54195 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gyG1I-00068n-Cd; Mon, 25 Feb 2019 05:10:08 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 8bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Mon, 25 Feb 2019 13:10:07 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:14
Message-ID: <084.eebc1f65e983bb28b63c4724577bb1c8@tools.ietf.org>
References: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-Trac-Ticket-ID: 396
In-Reply-To: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/vesYK90G9M4GYxs7pcWQjqGHg7E>
Subject: Re: [xml2rfc] #396 (Version_3_cli_html): SVG in HTML does not display (depending on namespace decls)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 13:10:10 -0000

#396: SVG in HTML does not display (depending on namespace decls)


Comment (by henrik@levkowetz.com):

 Replying to [comment:13 julian.reschke@…]:


 > FWIW, for now, the only place where xmlns declarations in HTML output
 are supposed to appear is on the SVG elements or it's descendants. That's
 relatively easy to enforce.

 Not so.  There's also the XInclude case.  And for that case, it definitely
 makes editing
 easier not to have to provide the namespace for each <xi:include>.

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_html     |    Version:  2.19.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:14>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Mon Feb 25 05:18:23 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 4BED6130EED for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 05:18:22 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id GX4Ezcru1ujD for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 05:18:20 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id C5AD7128CB7 for <xml2rfc@ietf.org>; Mon, 25 Feb 2019 05:18:20 -0800 (PST)
Received: from localhost ([::1]:54423 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gyG9E-0006N1-8N; Mon, 25 Feb 2019 05:18:20 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Mon, 25 Feb 2019 13:18:20 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:15
Message-ID: <084.c5ab6bf242ebdd1f78fc3fbff41738cb@tools.ietf.org>
References: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-Trac-Ticket-ID: 396
In-Reply-To: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/HPnQWg3ONmk8wgnXiqCm55kyyc0>
Subject: Re: [xml2rfc] #396 (Version_3_cli_html): SVG in HTML does not display (depending on namespace decls)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 13:18:22 -0000

#396: SVG in HTML does not display (depending on namespace decls)


Comment (by julian.reschke@gmx.de):

 ...in *HTML* output...

 There will be no XIncludes in HTML output, no?

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_html     |    Version:  2.19.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:15>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Mon Feb 25 05:33:42 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 972BD130EFE for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 05:33:40 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id XZi8zCdR5rQ8 for <xml2rfc@ietfa.amsl.com>; Mon, 25 Feb 2019 05:33:39 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 1C838130EDD for <xml2rfc@ietf.org>; Mon, 25 Feb 2019 05:33:39 -0800 (PST)
Received: from localhost ([::1]:54789 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gyGO2-0006rp-KP; Mon, 25 Feb 2019 05:33:38 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 8bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com, julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Mon, 25 Feb 2019 13:33:38 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:16
Message-ID: <084.7eb3596a1b05a9bab6e080306ea2327e@tools.ietf.org>
References: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-Trac-Ticket-ID: 396
In-Reply-To: <069.605522d2f81282823cd591d2470e4135@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/wz2Ii0efJR7R2106mEpJeUQjQNI>
Subject: Re: [xml2rfc] #396 (Version_3_cli_html): SVG in HTML does not display (depending on namespace decls)
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Mon, 25 Feb 2019 13:33:40 -0000

#396: SVG in HTML does not display (depending on namespace decls)


Comment (by henrik@levkowetz.com):

 Replying to [comment:15 julian.reschke@…]:
 > ...in *HTML* output...
 >
 > There will be no XIncludes in HTML output, no?

 Oh, sorry; quite right.

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_html     |    Version:  2.19.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/396#comment:16>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Tue Feb 26 13:24:20 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 82D6D129A87; Tue, 26 Feb 2019 13:24:05 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.9
X-Spam-Level: 
X-Spam-Status: No, score=-1.9 tagged_above=-999 required=5 tests=[BAYES_00=-1.9] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 2gnVZyRDPmqW; Tue, 26 Feb 2019 13:24:03 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 7168E12941A; Tue, 26 Feb 2019 13:24:03 -0800 (PST)
Received: from henrik by durif.tools.ietf.org with local (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gykCp-0004a5-4w; Tue, 26 Feb 2019 13:24:03 -0800
To: xml2rfc-dev@ietf.org, xml2rfc@ietf.org
Cc: rfc-markdown@ietf.org
Message-Id: <E1gykCp-0004a5-4w@durif.tools.ietf.org>
From: Henrik Levkowetz <henrik@levkowetz.com>
Date: Tue, 26 Feb 2019 13:24:03 -0800
X-SA-Exim-Connect-IP: <locally generated>
X-SA-Exim-Rcpt-To: rfc-markdown@ietf.org, xml2rfc-dev@ietf.org, xml2rfc@ietf.org
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/Fnd9o1yfT6P47dTrmbgm7yYEog0>
Subject: [xml2rfc] New xml2rfc release: v2.20.0
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Tue, 26 Feb 2019 21:24:06 -0000

Hi,

This is an automatic notification about a new xml2rfc release, 
v2.20.0, generated when running the mkrelease script.

Release notes:

xml2rfc (2.20.0) ietf; urgency=medium

  This release changes the rendering of <xref> elements with text content by
  v3 formatters, and reintroduces <xref format="none"> under v3 in order to
  properly cover the combinatorial space of rendering of <xref> with and
  without text content.  It fixes a number of issues, including a somewhat
  unexpected issue with namespace normalization, and improves the rendering
  output in some edge cases.  More details from the commit log:

  * Removed namespace cleanup and normalisation during the v2v3 conversion, 
    as it can have negative effects for inlined <svg> when the SVG namespace is 
    specified in multiple places.

  * Changed handling of reference//author entries with fullname but without
    initials and surname in order to derive those the same way for references
    as it's done in other places.

  * Dropped support for Py34.  Support is now Py27 (untill end 2019), and
    Python 3.5 - 3.7.

  * Tweaked the CSS for bcp14 keyword elements.

  * Fixed a problem where a temporary valuable name stomped on a 
    method-wide name.

  * Fixed a problem where <xref> "relative" attributes were treated as 
    fragment identifiers instead of as relative URL paths.

  * Improved the placeholder text emitted by the v3 text renderer for 
    artwork without ascii-art.

  * Removed stripping of the now (again) functional <xref> format value "none"
    from the v2v3 converter.

  * Tweaked the rendering of <xref> having both derivedContent (section 
    information, for instance) and text content, to generate hyperlinks to the 
    xref target for both of them.  Simplified the html renderer by eliminating 
    extra code for <relref>, now covered by the generic <xref> code.

  * Fixed a problem with a missing hash character between path and fragment 
    identifiers in derivedLink generation.

  * Added a conversion of <relref> elements to the generic <xref> form to 
    preptool.  Tweaked a debug print statement.

  * Added An SVG diagram of the processing flow for v2 and v3 documents, used
    by xml2rfc3.rst, to doc/

  * Added an rST-formatted Introduction to xml2rfc version 3 to doc/

 -- Henrik Levkowetz <henrik@levkowetz.com>  26 Feb 2019 13:22:09 -0800

The preferred way to install xml2rfc is by doing 'pip install xml2rfc',
and 'pip install --upgrade xml2rfc' to upgrade.  If there are system-
installed python modules which pip will not upgrade, you may have to
use 'pip install --upgrade --no-deps xml2rfc' and install dependencies
manually.

The new version is also available through SVN checkout, with
  'svn checkout http://svn.tools.ietf.org/svn/tools/xml2rfc/tags/cli/2.20.0'

Regards,

	Henrik
	(via the mkrelease script)


From nobody Tue Feb 26 21:30:55 2019
Return-Path: <julian.reschke@gmx.de>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id C6498130E57 for <xml2rfc@ietfa.amsl.com>; Tue, 26 Feb 2019 21:30:53 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -2.6
X-Spam-Level: 
X-Spam-Status: No, score=-2.6 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, FREEMAIL_FROM=0.001, RCVD_IN_DNSWL_LOW=-0.7, SPF_PASS=-0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id pzTw-epJf2Kx for <xml2rfc@ietfa.amsl.com>; Tue, 26 Feb 2019 21:30:52 -0800 (PST)
Received: from mout.gmx.net (mout.gmx.net [212.227.17.21]) (using TLSv1.2 with cipher ECDHE-RSA-AES128-GCM-SHA256 (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 84B2112D4EC for <xml2rfc@ietf.org>; Tue, 26 Feb 2019 21:30:51 -0800 (PST)
Received: from [192.168.178.124] ([91.61.53.40]) by mail.gmx.com (mrgmx101 [212.227.17.168]) with ESMTPSA (Nemesis) id 0MbbWD-1ggW8Z41Yb-00J6Y2 for <xml2rfc@ietf.org>; Wed, 27 Feb 2019 06:30:47 +0100
To: xml2rfc@ietf.org
References: <E1gykCp-0004a5-4w@durif.tools.ietf.org>
From: Julian Reschke <julian.reschke@gmx.de>
Message-ID: <e1e57601-4831-fafe-af5f-8df725df7675@gmx.de>
Date: Wed, 27 Feb 2019 06:30:47 +0100
User-Agent: Mozilla/5.0 (Windows NT 10.0; WOW64; rv:60.0) Gecko/20100101 Thunderbird/60.5.1
MIME-Version: 1.0
In-Reply-To: <E1gykCp-0004a5-4w@durif.tools.ietf.org>
Content-Type: text/plain; charset=utf-8; format=flowed
Content-Language: en-US
Content-Transfer-Encoding: 7bit
X-Provags-ID: V03:K1:hh3tnaatYmxPPzQsTFNMNfj40p57WZ9mMVDzTa+clBc5ywezwhC mrjxYKik9d54VO+LMh6jBX2tOaiPErURGYN6eYHBns46Gs28Qjg+nDTa7Or+WTr1mH941pX yOCHYpyNVOEpbZtZyKsKriwZgLqp53P/GA8Ig3AmS3It4bA7Z2CH7XP4fz3T9Li5krDSd26 MJvDFZHPDa28v1L9fQPwQ==
X-UI-Out-Filterresults: notjunk:1;V03:K0:eY4Hm300J7A=:qu4Rkkf8yJjePEYyBaOd96 DtW+AMpVzEqY3X6Fae50/d/FeOeGfOuVZx7YQsYxcp+JG4sMRJT9Iy08FAnAJ/3nj8hJDtXRh L/4eD9vOzZiOp+sJsfyO/Rkjvk90YlcUD/o/sTjIgIKSX/CGP7qv9c/nugvSnQ/Btlb/9HFyT GSYV44RAUK0Ab2KQQ1HTGBp/cVn6fj+1A+pu0QeP/FOkALwB1DF3Tfnaugil6QUw4zepmlmR9 6oarcPPsu65mO3XSUblf6plJbm+hF8SxSZcFe3L2J+Fsu+vPblKekzsvsjmnM4d9KIDsHJ70U TLFK1bUXjPE9UzjEm0O7HkXmiBdWHhHp693b0n9sgeS94pJbjcy9VkeEvEmzOl9ANrVARXPs4 jyflxinOLfR2O+/gjNaDWd8GmrSSxWI1VkNLcnjHrbH7kF3FWjkbSA4KVjXyKzJOPEJde705G mTARm8dY8BDq3M124Yyel+QJbOo0JpnNkqnSrBcjorO/MUPYgF1S70onyRJuJ7No8+lBs1Ole q0YlEaSVmySe22mMQrzhaNNknix+jG2i9Gi1qehwJVSWOtWOtlWF0+CBS71FsVl6eN9Z9Oogw heDunLowFw/kYKeOVuCeUUmiVA92Hm8tl2if+EdlwDbtVEfZZ8/q/3deQrEelfWis9kyoUW3p +CqN4qylPv3gpFNzUgk211969Ej5c7GgbTj5nfGUDJEPu3ZnUj/Ed+1FLjBSgosnn36Ism9l8 ouqo8hJYpGe6dJUYcp9t4XcVkne5TYd4R4sXKbGb0hmGoCgcOn3/9BLw8oy/B1PzxsmrPJT22 jtdk6BFuYA+lB0xKMV/t2SQPymLX/s2EtIqXPm93Vl7pDnWCB2/iaN+KBd8N34o7uIUbeMqg1 uRfet+udUvDmUJEMnJ2MfYwMmpQQ4WYWOqhMTVP9Fclk7X2hZX4hh5Fmmljp1xshie31rVcVb nx1t5vqrD6Q==
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/msllMNOG9ZnxI_eVgG6Ya06Wr2k>
Subject: Re: [xml2rfc] [Rfc-markdown] New xml2rfc release: v2.20.0
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 27 Feb 2019 05:30:54 -0000

On 26.02.2019 22:24, Henrik Levkowetz wrote:
> ...
> Release notes:
> 
> xml2rfc (2.20.0) ietf; urgency=medium
> 
>    This release changes the rendering of <xref> elements with text content by
>    v3 formatters, and reintroduces <xref format="none"> under v3 in order to
 > ...

Could you clarify/document what the change is? It sounds like rendering 
now varies between formatters?

> ... >    * Changed handling of reference//author entries with fullname but 
without
>      initials and surname in order to derive those the same way for references
>      as it's done in other places.
> ...

There are heuristics, right? The vocabulary captures initials/give name 
separately because - as far as I understand - there is no reliable way 
to derive those from the full name.

There are two issues here:

- rendering will vary between different implementations
- certain locales are getting a better treatment than others; something 
we wanted to avoid in the vocabulary definition

Could you please document the heuristics that you are using?

Best regards, Julian


From nobody Tue Feb 26 22:06:03 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 7F3E3130E2E for <xml2rfc@ietfa.amsl.com>; Tue, 26 Feb 2019 22:06:02 -0800 (PST)
X-Quarantine-ID: <DWM3C3blqQeh>
X-Virus-Scanned: amavisd-new at amsl.com
X-Amavis-Alert: BANNED, message contains text/plain,.exe
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id DWM3C3blqQeh for <xml2rfc@ietfa.amsl.com>; Tue, 26 Feb 2019 22:05:59 -0800 (PST)
Received: from zinfandel.tools.ietf.org (zinfandel.tools.ietf.org [IPv6:2001:1890:126c::1:2a]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id A550A126C7E for <xml2rfc@ietf.org>; Tue, 26 Feb 2019 22:05:59 -0800 (PST)
Received: from h-202-242.a357.priv.bahnhof.se ([158.174.202.242]:54969 helo=tannat.localdomain) by zinfandel.tools.ietf.org with esmtpsa (TLS1.2:DHE_RSA_AES_128_CBC_SHA1:128) (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gysLu-0006wa-Fo; Tue, 26 Feb 2019 22:05:59 -0800
To: Julian Reschke <julian.reschke@gmx.de>, xml2rfc@ietf.org
References: <E1gykCp-0004a5-4w@durif.tools.ietf.org> <e1e57601-4831-fafe-af5f-8df725df7675@gmx.de>
From: Henrik Levkowetz <henrik@levkowetz.com>
Message-ID: <07638082-4749-1adb-8230-cd25cfe21677@levkowetz.com>
Date: Wed, 27 Feb 2019 07:05:50 +0100
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.11; rv:45.0) Gecko/20100101 Thunderbird/45.8.0
MIME-Version: 1.0
In-Reply-To: <e1e57601-4831-fafe-af5f-8df725df7675@gmx.de>
Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="lE7EL0aWSkboUMUrue2t5gSq7WagBwK1W"
X-SA-Exim-Connect-IP: 158.174.202.242
X-SA-Exim-Rcpt-To: xml2rfc@ietf.org, julian.reschke@gmx.de
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Version: 4.2.1 (built Mon, 26 Dec 2011 16:24:06 +0000)
X-SA-Exim-Scanned: Yes (on zinfandel.tools.ietf.org)
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/byvG-y0AyPrq3g6xCq8MzkLBbEs>
Subject: Re: [xml2rfc] [Rfc-markdown] New xml2rfc release: v2.20.0
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 27 Feb 2019 06:06:03 -0000

This is an OpenPGP/MIME signed message (RFC 4880 and 3156)
--lE7EL0aWSkboUMUrue2t5gSq7WagBwK1W
Content-Type: multipart/mixed; boundary="kIJ7tBWagNx5E1R6KKv7MfMEc9iF8eeS8";
 protected-headers="v1"
From: Henrik Levkowetz <henrik@levkowetz.com>
To: Julian Reschke <julian.reschke@gmx.de>, xml2rfc@ietf.org
Message-ID: <07638082-4749-1adb-8230-cd25cfe21677@levkowetz.com>
Subject: Re: [xml2rfc] [Rfc-markdown] New xml2rfc release: v2.20.0
References: <E1gykCp-0004a5-4w@durif.tools.ietf.org>
 <e1e57601-4831-fafe-af5f-8df725df7675@gmx.de>
In-Reply-To: <e1e57601-4831-fafe-af5f-8df725df7675@gmx.de>

--kIJ7tBWagNx5E1R6KKv7MfMEc9iF8eeS8
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: quoted-printable


On 2019-02-27 06:30, Julian Reschke wrote:
> On 26.02.2019 22:24, Henrik Levkowetz wrote:
>> ...
>> Release notes:
>>=20
>> xml2rfc (2.20.0) ietf; urgency=3Dmedium
>>=20
>>    This release changes the rendering of <xref> elements with text con=
tent by
>>    v3 formatters, and reintroduces <xref format=3D"none"> under v3 in =
order to
>  > ...
>=20
> Could you clarify/document what the change is? It sounds like rendering=
=20
> now varies between formatters?

The rendering prescribed by 7991 and 7998 differed substantially from tha=
t
of the legacy renderers.  This change brings them closer again, as well a=
s
permitting a richer range of expression.  7998 forced the rendering to
ignore the "format" attribute whenever <xref> held text; this is not the
case any more, and has never been the case for v2.  Additional details ar=
e
provided here:

https://tools.ietf.org/html/draft-levkowetz-xml2rfc-v3-implementation-not=
es-08#section-4.4.17

but I need to update the draft, as I got the release that would contain
this change wrong when I wrote the draft text.

>> ... >    * Changed handling of reference//author entries with fullname=
 but=20
> without
>>      initials and surname in order to derive those the same way for re=
ferences
>>      as it's done in other places.
>> ...
>=20
> There are heuristics, right? The vocabulary captures initials/give name=
=20
> separately because - as far as I understand - there is no reliable way =

> to derive those from the full name.

It's algorithmic, and falls back on the fullname only if initials/surname=

are absent:

def short_author_name_parts(a):
    initials =3D a.get('initials')
    surname  =3D a.get('surname')
    if initials!=3DNone and surname!=3DNone:
        if initials and not initials.endswith('.') and is_script(initials=
, 'Latin'):
            initials +=3D '.'
        parts =3D [initials, surname]
    else:
        fullname =3D a.get('fullname') or ''
        if fullname:
            if len(fullname.split())>1:
                parts =3D fullname.split()
                initials =3D ' '.join([ "%s."%n[0].upper() for n in parts=
[:-1] ])
                surname  =3D parts[-1]
                parts =3D [initials, surname ]
            else:
                parts =3D [ None, fullname ]
        else:
            parts =3D [None, None]
    return parts

>=20
> There are two issues here:
>=20
> - rendering will vary between different implementations

The alternative is to omit the name, which results in surprise, since
deriving the initials and surname has been in practice for the front
matter for a long time.

> - certain locales are getting a better treatment than others; something=
=20
> we wanted to avoid in the vocabulary definition

I don't see that.  Expressly provided initials and surname always takes
precedence; you can see this as a shortcut.

> Could you please document the heuristics that you are using?

It's not heuristics, and the algorithm is provided above.


	Henrik


--kIJ7tBWagNx5E1R6KKv7MfMEc9iF8eeS8--

--lE7EL0aWSkboUMUrue2t5gSq7WagBwK1W
Content-Type: application/pgp-signature; name="signature.asc"
Content-Description: OpenPGP digital signature
Content-Disposition: attachment; filename="signature.asc"

-----BEGIN PGP SIGNATURE-----

iQIzBAEBCAAdFiEEifjc5+rnL1MJBcZSTptXS4+7FxoFAlx2KL8ACgkQTptXS4+7
FxoLjRAAz6/1aq7G5hM1APz+dkoZROt79csC8GrPMvIGuZ9/IXjs3hyyQ56jrNQd
3Xb3KkDKWat2N/vq6+y8pG08ZBGeR3H5U2bEQWQzIXKv2E3xuUbP77wConP8+hFj
NNujyz2KewWRLr+pSOhbqSfmAf7OzPku9XZaVvk+Rftg4AGH4+A87bPgqCztx1VX
4+iSoJCz/xdV5HIR00iYqcjBur4ZQ+3sK58UASA55dNkLVIaSrNSxiGAUXcGXYth
/MlZeWxt82nW5nBcfYiaH9wM/LmDq3G/7zMuI8axmfO4B+WJwMoFn3qPxk9dI1jw
q3dVhwUovIfnoWSLQTshC92unfqml7l5FLHHk8NovCgwjLsRs/6GEvH/O40AG1Qb
GplaGOqLa6GYcOLvz1YwEWI/YjukBM7hw8sPXaOQQTiwHT+3378HGcm3ISsS84+b
dmx6h/5S8kugMEZlWUCEouGR9dZifUeKQWAHOPlQg451pbtGWk95qAoqUBQS+6/g
e3YxwF40c7vRY2nEWQxtpwtCB4bF7M8FrvTR52I3rHMZknK742/bF0Qrtb6f7mxC
fWOM3V7jRbOobs+IwlQSW4bWudMHdBuzjEDPDtZ6D0ZVAFDqNa4o2648YrXBhD8D
GwohMaXq8r+hPH9Sex6dgWnuBeLkF5FHoihu6MgsaENdDuhSD3I=
=AbR1
-----END PGP SIGNATURE-----

--lE7EL0aWSkboUMUrue2t5gSq7WagBwK1W--


From nobody Wed Feb 27 03:18:13 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id B615713101F for <xml2rfc@ietfa.amsl.com>; Wed, 27 Feb 2019 03:18:01 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id pHkcMqcYTK9H for <xml2rfc@ietfa.amsl.com>; Wed, 27 Feb 2019 03:18:00 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 36176130FF7 for <xml2rfc@ietf.org>; Wed, 27 Feb 2019 03:18:00 -0800 (PST)
Received: from localhost ([::1]:57286 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gyxDr-0006FK-HX; Wed, 27 Feb 2019 03:17:59 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: julian.reschke@gmx.de
X-Trac-Project: xml2rfc
Date: Wed, 27 Feb 2019 11:17:59 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/397
Message-ID: <069.0807c56df023bc3477aef6fb8c0bde4c@tools.ietf.org>
X-Trac-Ticket-ID: 397
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: julian.reschke@gmx.de, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/qcZrHAZ4YjaUfq7EWnWgV4DUB9U>
Subject: [xml2rfc] #397 (Version_3_cli_txt): xml2rfc crash in handling <author>
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 27 Feb 2019 11:18:07 -0000

#397: xml2rfc crash in handling <author>

 Output:


 {{{
 Traceback (most recent call last):
   File "/bin/xml2rfc", line 10, in <module>
     sys.exit(main())
   File "/usr/lib/python2.7/site-packages/xml2rfc/run.py", line 474, in
 main
     pagedwriter.write(filename)
   File "/usr/lib/python2.7/site-packages/xml2rfc/writers/base.py", line
 1417, in write
     self._build_document()
   File "/usr/lib/python2.7/site-packages/xml2rfc/writers/base.py", line
 1355, in _build_document
     self.write_reference_list(reference_list)
   File "/usr/lib/python2.7/site-packages/xml2rfc/writers/raw_txt.py", line
 754, in write_reference_list
     author_string = self._format_author_string(authors)
   File "/usr/lib/python2.7/site-packages/xml2rfc/writers/base.py", line
 707, in _format_author_string
     elif len(initials) > 0:
 TypeError: object of type 'NoneType' has no len()
 }}}

 I suspect that this has to do with the changes from 2.19.

-- 
-----------------------------------+--------------------
 Reporter:  julian.reschke@gmx.de  |      Owner:
     Type:  defect                 |     Status:  new
 Priority:  medium                 |  Milestone:
Component:  Version_3_cli_txt      |    Version:  2.20.*
 Keywords:                         |
-----------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/397>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb 27 04:24:59 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id CEBFF130EBF for <xml2rfc@ietfa.amsl.com>; Wed, 27 Feb 2019 04:24:57 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id ANIL9Rgf7XDY for <xml2rfc@ietfa.amsl.com>; Wed, 27 Feb 2019 04:24:56 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 3A863130EB4 for <xml2rfc@ietf.org>; Wed, 27 Feb 2019 04:24:56 -0800 (PST)
Received: from localhost ([::1]:60270 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gyyGb-0006RD-47; Wed, 27 Feb 2019 04:24:53 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com
X-Trac-Project: xml2rfc
Date: Wed, 27 Feb 2019 12:24:53 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/397#comment:1
Message-ID: <084.ae1d1fa633b2aa67c25817e9b88db24f@tools.ietf.org>
References: <069.0807c56df023bc3477aef6fb8c0bde4c@tools.ietf.org>
X-Trac-Ticket-ID: 397
In-Reply-To: <069.0807c56df023bc3477aef6fb8c0bde4c@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/btZvCOlMjh2AfPB_jyIY5nN3uQY>
Subject: Re: [xml2rfc] #397 (Version_3_cli_txt): xml2rfc crash in handling <author>
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 27 Feb 2019 12:24:58 -0000

#397: xml2rfc crash in handling <author>


Comment (by henrik@levkowetz.com):

 Command line switches used?

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  new
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_txt      |    Version:  2.20.*
Resolution:                         |   Keywords:
------------------------------------+--------------------

Ticket URL: <https://trac.tools.ietf.org/tools/xml2rfc/trac/ticket/397#comment:1>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb 27 04:33:24 2019
Return-Path: <trac@tools.ietf.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 75582130EC5 for <xml2rfc@ietfa.amsl.com>; Wed, 27 Feb 2019 04:33:23 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id DLmKrc1jJj8i for <xml2rfc@ietfa.amsl.com>; Wed, 27 Feb 2019 04:33:22 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 24FA6130EB8 for <xml2rfc@ietf.org>; Wed, 27 Feb 2019 04:33:22 -0800 (PST)
Received: from localhost ([::1]:60596 helo=durif.tools.ietf.org) by durif.tools.ietf.org with esmtp (Exim 4.80) (envelope-from <trac@tools.ietf.org>) id 1gyyOk-0007EU-LO; Wed, 27 Feb 2019 04:33:21 -0800
MIME-Version: 1.0
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: 7bit
From: "xml2rfc issue tracker" <trac@tools.ietf.org>
X-Trac-Version: 0.12.5
Precedence: bulk
Cc: xml2rfc@ietf.org
Auto-Submitted: auto-generated
X-Mailer: Trac 0.12.5, by Edgewall Software
To: henrik@levkowetz.com
X-Trac-Project: xml2rfc
Date: Wed, 27 Feb 2019 12:33:18 -0000
X-URL: http://tools.ietf.org/tools/xml2rfc/
X-Trac-Ticket-URL: /ticket/397#comment:2
Message-ID: <084.34b36d2a20c0a17ba999c274e1c45cf5@tools.ietf.org>
References: <069.0807c56df023bc3477aef6fb8c0bde4c@tools.ietf.org>
X-Trac-Ticket-ID: 397
In-Reply-To: <069.0807c56df023bc3477aef6fb8c0bde4c@tools.ietf.org>
X-SA-Exim-Connect-IP: ::1
X-SA-Exim-Rcpt-To: henrik@levkowetz.com, xml2rfc@ietf.org
X-SA-Exim-Mail-From: trac@tools.ietf.org
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/k1tN6p_lqQqjGP2imKTV4P1XO-c>
Subject: Re: [xml2rfc] #397 (Version_3_cli_txt): xml2rfc crash in handling <author>
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 27 Feb 2019 12:33:23 -0000

#397: xml2rfc crash in handling <author>

Changes (by henrik@levkowetz.com):

 * status:  new => closed
 * resolution:   => fixed


Comment:

 Fixed in [3032]:

 Handle initials==Null return value from short_author_name_parts().  Fixes
 issue #397

-- 
------------------------------------+--------------------
  Reporter:  julian.reschke@gmx.de  |      Owner:
      Type:  defect                 |     Status:  closed
  Priority:  medium                 |  Milestone:
 Component:  Version_3_cli_txt      |    Version:  2.20.*
Resolution:  fixed                  |   Keywords:
------------------------------------+--------------------

Ticket URL: </ticket/397#comment:2>
xml2rfc <http://tools.ietf.org/tools/xml2rfc/>


From nobody Wed Feb 27 05:15:19 2019
Return-Path: <henrik@levkowetz.com>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id AFAE0130FCA; Wed, 27 Feb 2019 05:15:11 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.899
X-Spam-Level: 
X-Spam-Status: No, score=-1.899 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id pskhc5SGM6OJ; Wed, 27 Feb 2019 05:15:08 -0800 (PST)
Received: from durif.tools.ietf.org (durif.tools.ietf.org [IPv6:2001:1900:3001:11::3d]) (using TLSv1.2 with cipher DHE-RSA-AES128-SHA (128/128 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id DD741130FC5; Wed, 27 Feb 2019 05:15:08 -0800 (PST)
Received: from henrik by durif.tools.ietf.org with local (Exim 4.80) (envelope-from <henrik@levkowetz.com>) id 1gyz3E-0002n4-NM; Wed, 27 Feb 2019 05:15:08 -0800
To: xml2rfc-dev@ietf.org, xml2rfc@ietf.org
Cc: rfc-markdown@ietf.org
Message-Id: <E1gyz3E-0002n4-NM@durif.tools.ietf.org>
From: Henrik Levkowetz <henrik@levkowetz.com>
Date: Wed, 27 Feb 2019 05:15:08 -0800
X-SA-Exim-Connect-IP: <locally generated>
X-SA-Exim-Rcpt-To: rfc-markdown@ietf.org, xml2rfc-dev@ietf.org, xml2rfc@ietf.org
X-SA-Exim-Mail-From: henrik@levkowetz.com
X-SA-Exim-Scanned: No (on durif.tools.ietf.org); SAEximRunCond expanded to false
X-Clacks-Overhead: GNU Terry Pratchett
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/E-OqL77LLe-ZduqPiPVkqxv73PQ>
Subject: [xml2rfc] New xml2rfc release: v2.20.1
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 27 Feb 2019 13:15:12 -0000

Hi,

This is an automatic notification about a new xml2rfc release, 
v2.20.1, generated when running the mkrelease script.

Release notes:

xml2rfc (2.20.1) ietf; urgency=medium

  * Handle initials==Null return value from short_author_name_parts().  
    Fixes issue #397

 -- Henrik Levkowetz <henrik@levkowetz.com>  27 Feb 2019 13:11:06 +0000

The preferred way to install xml2rfc is by doing 'pip install xml2rfc',
and 'pip install --upgrade xml2rfc' to upgrade.  If there are system-
installed python modules which pip will not upgrade, you may have to
use 'pip install --upgrade --no-deps xml2rfc' and install dependencies
manually.

The new version is also available through SVN checkout, with
  'svn checkout http://svn.tools.ietf.org/svn/tools/xml2rfc/tags/cli/2.20.1'

Regards,

	Henrik
	(via the mkrelease script)


From nobody Wed Feb 27 05:51:30 2019
Return-Path: <cabo@tzi.org>
X-Original-To: xml2rfc@ietfa.amsl.com
Delivered-To: xml2rfc@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id 46370130FCE for <xml2rfc@ietfa.amsl.com>; Wed, 27 Feb 2019 05:50:53 -0800 (PST)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -4.199
X-Spam-Level: 
X-Spam-Status: No, score=-4.199 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, RCVD_IN_DNSWL_MED=-2.3, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id 5QAh_ra087cM for <xml2rfc@ietfa.amsl.com>; Wed, 27 Feb 2019 05:50:52 -0800 (PST)
Received: from mailhost.informatik.uni-bremen.de (mailhost.informatik.uni-bremen.de [IPv6:2001:638:708:30c9::12]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id B2F15130FCB for <xml2rfc@ietf.org>; Wed, 27 Feb 2019 05:50:51 -0800 (PST)
X-Virus-Scanned: amavisd-new at informatik.uni-bremen.de
Received: from submithost.informatik.uni-bremen.de (submithost2.informatik.uni-bremen.de [IPv6:2001:638:708:30c8:406a:91ff:fe74:f2b7]) by mailhost.informatik.uni-bremen.de (8.14.5/8.14.5) with ESMTP id x1RDogar028696; Wed, 27 Feb 2019 14:50:47 +0100 (CET)
Received: from [192.168.217.106] (p54A6C2FE.dip0.t-ipconnect.de [84.166.194.254]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by submithost.informatik.uni-bremen.de (Postfix) with ESMTPSA id 448cX15mPXz1Bp8; Wed, 27 Feb 2019 14:50:41 +0100 (CET)
Content-Type: text/plain; charset=utf-8
Mime-Version: 1.0 (Mac OS X Mail 11.5 \(3445.9.1\))
From: Carsten Bormann <cabo@tzi.org>
In-Reply-To: <07638082-4749-1adb-8230-cd25cfe21677@levkowetz.com>
Date: Wed, 27 Feb 2019 14:50:40 +0100
Cc: Julian Reschke <julian.reschke@gmx.de>, xml2rfc@ietf.org
X-Mao-Original-Outgoing-Id: 572968237.3580869-27e3d78aa7b4e2f7b658215a7d2b1f5f
Content-Transfer-Encoding: quoted-printable
Message-Id: <0C3B41BD-A5E9-4C1F-9C4A-9FF2C4F75E24@tzi.org>
References: <E1gykCp-0004a5-4w@durif.tools.ietf.org> <e1e57601-4831-fafe-af5f-8df725df7675@gmx.de> <07638082-4749-1adb-8230-cd25cfe21677@levkowetz.com>
To: Henrik Levkowetz <henrik@levkowetz.com>
X-Mailer: Apple Mail (2.3445.9.1)
Archived-At: <https://mailarchive.ietf.org/arch/msg/xml2rfc/wF8yaTS6KIOrYF1O5zhje3pL94M>
Subject: Re: [xml2rfc] [Rfc-markdown] New xml2rfc release: v2.20.0
X-BeenThere: xml2rfc@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: <xml2rfc.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/xml2rfc/>
List-Post: <mailto:xml2rfc@ietf.org>
List-Help: <mailto:xml2rfc-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/xml2rfc>, <mailto:xml2rfc-request@ietf.org?subject=subscribe>
X-List-Received-Date: Wed, 27 Feb 2019 13:50:53 -0000

On Feb 27, 2019, at 07:05, Henrik Levkowetz <henrik@levkowetz.com> =
wrote:
>=20
>                surname  =3D parts[-1]

Well, that is certainly heuristics (fails, e.g., with Spanish names, =
where the second-to-last is the usual patrimonial surname).
But I agree that it is sane to perform these heuristics, as opposed to =
completely leaving out the author as I have seen before.

Gr=C3=BC=C3=9Fe, Carsten

